KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107277547
Entry
107277547         CDS       T01015                                 
Name
(RefSeq) probable prolyl 4-hydroxylase 7
  KO
K00472  prolyl 4-hydroxylase [EC:1.14.11.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    107277547
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.2  procollagen-proline 4-dioxygenase
     107277547
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy NtrY_N
Other DBs
NCBI-GeneID: 107277547
NCBI-ProteinID: XP_015629456
LinkDB
Position
3:3566695..3568956
AA seq 181 aa
MARLVLLAVLPLLLLFVAGDSYATAAGGGGGGGGRRFDASRAVDVSWRPRAFLYEGFLSD
AECDHLISLAKQGKMEKSTVVDGESGESVTSKVRTSSGMFLDKKQDEVVARIEERIAAWT
MLPTENGESMQILRYGQGEKYEPHFDYISGRQGSTREGDRVATVLMYLSNVKMGGETIFP
D
NT seq 546 nt   +upstreamnt  +downstreamnt
atggctcgtctcgtcctcctcgccgtactacctctcctcctcctcttcgtcgccggcgac
tcgtacgccaccgccgccggcggcggcggcgggggaggaggacggcgattcgacgcctcc
cgcgccgtcgatgtctcgtggcgccccagagcgttcctgtacgaggggttcctgtcggat
gcggagtgcgaccacctcatctcgctcgcgaagcagggtaagatggagaagtcgacggtg
gtggacggcgagtcgggggagagcgtgacgagcaaggtgaggaccagctccggcatgttc
ctcgacaagaagcaggatgaagttgttgcaagaatagaggagaggattgcggcttggacc
atgcttccaacagaaaacggtgaatcgatgcaaatactacgttacgggcaaggtgagaaa
tacgagccacactttgattacattagcggacggcaaggctcaactcgtgaaggtgaccgg
gttgccactgtgctcatgtacctgtccaatgtcaagatgggtggtgagaccatcttccct
gattga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107280232
Entry
107280232         CDS       T01015                                 
Name
(RefSeq) probable prolyl 4-hydroxylase 4
  KO
K00472  prolyl 4-hydroxylase [EC:1.14.11.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    107280232
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.2  procollagen-proline 4-dioxygenase
     107280232
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy ShK
Other DBs
NCBI-GeneID: 107280232
NCBI-ProteinID: XP_015628812
UniProt: Q10BV7
LinkDB
Position
3:complement(33519939..33522415)
AA seq 310 aa
MEMRRLLVLFALLSVTAVVPVFLWPDKKGGASDVAVVVAAPPFNASSVTIISWKPRIFFY
KGFLSDDECDHLVKLGKEKLKRSMVADNESGKSVMSEVRTSSGMFLDKQQDPVVSGIEER
IAAWTLLPQENAENIQILRYENGQKYDPHFDYFQDKVNQLQGGHRYATVLTYLSTVEKGG
ETVFPNAEGWESQPKDDSFSDCAKKGLAVKAVKGDSVLFFNLQPDGTPDPLSLHGSCPVI
EGEKWSAPKWIHVRSYDNASSMKQSEECSDLSENCAAWAASGECNNNAVYMIGTEDAPGQ
CQKSCNACSL
NT seq 933 nt   +upstreamnt  +downstreamnt
atggagatgcgtcgccttcttgtcttgttcgctctcctctccgtcaccgccgtcgtcccg
gtgttcttatggcccgacaagaagggcggtgctagtgacgtcgccgtcgtcgtcgcggcg
cctccgttcaatgcgtccagcgtcaccattatctcctggaaaccgaggatatttttttac
aagggcttcctttcagatgatgagtgcgaccaccttgtcaagttggggaaggagaagctg
aagaggtccatggtggcagacaatgagtcgggaaagagtgttatgagcgaagtgcgcacc
agctctggcatgttcttggacaaacaacaggaccctgttgttagcggtattgaggagaga
attgcagcttggaccctgcttccgcaagagaatgctgagaacattcagatactccgatac
gagaacggacaaaaatatgatcctcattttgattattttcaagacaaagtcaatcaactg
cagggcggtcaccgttatgcaacggtgctgacatatctatcaactgttgagaaaggaggt
gaaaccgtcttcccaaatgctgaggggtgggaatctcaacctaaagatgattcattttca
gactgtgcaaaaaagggcttggcagtgaaagcagtgaagggtgattctgtgctgttcttt
aatcttcagcctgatggcacaccagacccgcttagcctccatggaagctgcccagttata
gagggcgagaaatggtctgcgccaaagtggattcatgtgcggtcttacgacaatgcatca
agcatgaagcaaagtgaagaatgttctgatttgagcgagaattgcgcggcttgggctgca
tcgggtgaatgcaataacaacgcagtctacatgattggaacggaagatgcacccggtcag
tgccagaagagttgcaatgcttgcagtttatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327127
Entry
4327127           CDS       T01015                                 
Name
(RefSeq) probable prolyl 4-hydroxylase 6 isoform X1
  KO
K00472  prolyl 4-hydroxylase [EC:1.14.11.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4327127
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.2  procollagen-proline 4-dioxygenase
     4327127
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 ShK 2OG-FeII_Oxy
Other DBs
NCBI-GeneID: 4327127
NCBI-ProteinID: XP_015622122
LinkDB
Position
1:complement(3827041..3830355)
AA seq 364 aa
MGLQTIALPKEMVLVWLLENCICRAREMRIWCSLVQVKRRRPEEGKRGRRMGSGIGAVLV
LVAAWLTFAPPGALASSRRFDLSIAQEKLVNSTGGSTASSSHLVFDPSKSKRLSWHPRIF
LYEGFLSDMECDHLVSMGRGNMESSLAFTDGDRNSSYNNIEVGLKVYLANSEDIVVSKIE
DRISLWSFLPKENGESIQVLKYGVNRSGSIKEEPKSSSGAHRLATILMYLSDVKQGGETV
FPRSEMKDAQAKEGAPSQCSGYAVRPAKGNAILLFNLRPDGETDKDSQYEECPVLEGEKW
LAIKHINLRKFDYPKSSLASEDECTDEDDRCVSWAASGECDRNPVFMIGSSDYYGSCRKS
CRVC
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgggcttgcagaccatcgctttgccgaaggaaatggttttggtttggttgttggagaat
tgtatatgcagggcgagagagatgcggatctggtgttctttagtgcaggtgaagaggagg
agaccggaggaggggaagagggggaggaggatgggatctgggattggagccgtgctggtg
cttgttgcagcatggctaacatttgcgccgcctggtgctctggcttcttcgcgcaggttt
gatctgagtattgcacaagaaaagttagtgaactccacaggtggttcaactgcttcaagc
tcacaccttgtttttgatccttcaaaatcaaagagactctcatggcatccaaggatcttc
ttgtatgaaggttttctttctgacatggagtgtgaccatttagtatctatgggacgtggt
aatatggagtcatctttagcatttactgatggtgatagaaatagttcgtataacaacatt
gaggtaggcctcaaagtgtacctagctaatagcgaagatatagttgtttccaagattgag
gacaggatatcgctatggagctttcttccaaaagaaaatggagagagcattcaggtcttg
aagtatggagtgaacagaagtggcagtatcaaggaggaacctaaatcaagcagtggtgcc
cataggcttgcgaccattttgatgtatctttctgatgtcaagcaaggtggtgaaactgtt
ttccccagatctgagatgaaggatgctcaagctaaggagggggcaccatctcaatgttct
ggttatgcagtgcgaccagccaagggcaatgcaatactgctgttcaatttaaggcctgat
ggagaaacagataaggatagccaatatgaagaatgtcctgtcctcgaaggagagaaatgg
ctagccataaaacatataaatttgagaaaatttgattatccaaaatcatcacttgcatcc
gaggatgagtgcacagatgaagatgataggtgtgtgagttgggctgctagtggtgagtgt
gacaggaatccggtgtttatgataggaagctcagactactatggctcttgccgaaagagc
tgtcgagtgtgctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331220
Entry
4331220           CDS       T01015                                 
Name
(RefSeq) probable prolyl 4-hydroxylase 3
  KO
K00472  prolyl 4-hydroxylase [EC:1.14.11.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4331220
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.2  procollagen-proline 4-dioxygenase
     4331220
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy
Other DBs
NCBI-GeneID: 4331220
NCBI-ProteinID: XP_015625559
UniProt: Q6K7Q8
LinkDB
Position
2:35545505..35548352
AA seq 310 aa
MAPSRPLMRGIRPPRVFPTRGGRTSPLALALAALLLASALLLALIAFGVFSLPVSAPNAA
TTDSAAAGGDAEPADPRPPRTRARRDLSEGLGERGAQWTEVISWEPRAFVYHNFLSKEEC
DYLIGLAKPHMVKSTVVDSTTGKSKDSRVRTSSGMFLQRGRDKVIRAIEKRIADYTFIPM
EHGEGLQVLHYEVGQKYEPHFDYFLDEYNTKNGGQRMATLLMYLSDVEEGGETIFPDANV
NSSSLPWYNELSECARKGLAVKPKMGDALLFWSMKPDATLDPLSLHGGCPVIKGNKWSST
KWMHVREYKA
NT seq 933 nt   +upstreamnt  +downstreamnt
atggcgccctcccgcccgctcatgcgcgggatccgcccgccgcgcgtcttccccacccgc
ggcggccgcacctcgcccttggccctcgccctcgccgccctcctcctcgcctccgccttg
ctcctcgccctcatcgccttcggcgtcttctccctcccggtctccgcccccaacgccgcc
accaccgactccgccgccgccgggggagacgccgagcccgccgatccacggcccccgcgc
acccgcgcccgccgcgaccttagcgagggccttggggaacgaggagcacaatggacggaa
gtcatatcatgggagcccagggctttcgtctatcacaatttcctgtccaaggaagagtgt
gattacttgattggattggccaagcctcacatggtcaaatccacggttgttgatagcact
actggtaaaagcaaggacagcagggtacgcacaagttcaggcatgtttctccaaagggga
cgagacaaggttattcgggccattgaaaagaggatagcagactacactttcattcctatg
gaacatggagagggactccaagttctgcactatgaagtcgggcagaagtacgagcctcac
tttgactattttcttgatgagtacaacaccaagaatggtggtcagagaatggctactctt
ctgatgtatctatctgatgttgaagaagggggtgagactattttccctgatgcaaatgtg
aacagcagttcattaccatggtataatgaactttcagagtgtgccagaaagggccttgct
gtcaaaccaaagatgggagatgcgcttcttttttggagcatgaaaccagatgccactcta
gaccctttaagtttgcatgggggttgtcctgtcatcaaaggaaacaaatggtcatcaacc
aagtggatgcatgtccgtgagtacaaagcttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331736
Entry
4331736           CDS       T01015                                 
Name
(RefSeq) probable prolyl 4-hydroxylase 6 isoform X1
  KO
K00472  prolyl 4-hydroxylase [EC:1.14.11.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4331736
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.2  procollagen-proline 4-dioxygenase
     4331736
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy ShK
Other DBs
NCBI-GeneID: 4331736
NCBI-ProteinID: XP_015629897
LinkDB
Position
3:3569779..3571886
AA seq 338 aa
MARLVLLVVLLLLLSVTGETSATGGGGEGGRFDASRTVDVSWSPRVFLYEGFLSDVECEH
LIALAKQGRMERSTVVNGKSGESVMSKTRTSSGMFLIRKQDEVVARIEERIAAWTMFPAG
MVQGHRTLENCLIGPCSKCSSECITFYCFARFVILERSENGESMQMLRYGQGEKYEPHFD
YIRGRQASARGGHRIATVLMYLSNVKMGGETVFPDAEARLSQPKDETWSDCAEQGFAVKP
TKGSAVLFFSLYPNATFDPGSLHGSCPVIQGEKWSATKWIHVRSYDENGRRSSDKCEDQH
ALCSSWAAAGECAKNPGYMVGTSESPGFCRKSCNVCTS
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggctcgtctcgtcctcctcgtcgtcctactgcttctcctctccgtcaccggcgagacg
tccgccaccggcggtggcggggaaggcgggcgattcgacgcctcccgcacagtcgatgtc
tcgtggagccccagggtgttcctgtacgaggggttcctgtcggatgtggagtgcgaacac
ctcatcgcgctggcgaagcagggtaggatggagaggtcgacggtggtaaacggcaagtcg
ggggagagcgtgatgagcaagacgaggaccagctccggcatgttcctcatcaggaaacag
gatgaagtcgttgcaagaatagaggagaggattgctgcttggaccatgtttccagcaggt
atggtgcaagggcacagaacactggaaaactgcttaattggaccttgctccaaatgttct
tcagagtgcatcaccttctattgctttgcccgttttgtgattcttgaacggtcagaaaac
ggtgaatctatgcaaatgctacgttatgggcaaggtgagaaatacgagccacactttgat
tacattcgcggacggcaagcctcagctcgtggaggtcatcggattgctactgtgctcatg
tacctgtccaatgtcaagatgggtggagagaccgtcttccccgatgcagaggctaggtta
tcacagcctaaagacgagacatggtccgactgcgcagaacagggcttcgcagtgaaacct
accaaaggcagtgcggtgctgttcttcagcctctaccccaacgcgacgttcgacccaggc
agcctgcacggaagctgccctgtcatacaaggcgagaagtggtcggcgacgaaatggatc
catgtgagatcctacgacgaaaatggccggagatcctcggacaaatgcgaggatcaacat
gctctctgctccagctgggctgctgctggagagtgtgccaagaaccccggttacatggtc
ggcaccagtgaatcccctggcttctgccggaagagttgcaacgtatgtacatcgtag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334196
Entry
4334196           CDS       T01015                                 
Name
(RefSeq) probable prolyl 4-hydroxylase 9
  KO
K00472  prolyl 4-hydroxylase [EC:1.14.11.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4334196
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.2  procollagen-proline 4-dioxygenase
     4334196
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy
Other DBs
NCBI-GeneID: 4334196
NCBI-ProteinID: XP_015629043
LinkDB
Position
3:31503627..31507966
AA seq 316 aa
MKGGVIRSGGGVGGIGVGGGGGGGGAGGGLMRTRLRLPVVLLSCSLFFLAGFFGSILFTQ
DPQGEEELDTPMRRERLMEAAWPGMAYGESGEPEPSLIPYQILSWQPRALYFPQFATSQQ
CENIVKTAKQRLMPSTLALRKGETEESTKGIRTSSGTFLSSDEDPTGTLAEVEKKIAKAT
MIPRHHGEPFNILRYEIGQRYASHYDAFDPAQYGPQKSQRVASFLLYLTDVEEGGETMFP
YENGENMDIGYDYEKCIGLKVKPRKGDGLLFYSLMVNGTIDPTSLHGSCPVIKGEKWVAT
KWIRDKRQENLLLWVT
NT seq 951 nt   +upstreamnt  +downstreamnt
atgaagggcggggtcatcaggagcggcggcggcgtcggcggcatcggcgtcggcggcggc
ggcggaggcgggggagccggcggggggctgatgcgcacgcggctgcgcctccccgtcgtg
ctcctctcctgctccctcttcttcctcgccggcttcttcggctccatcctcttcacccag
gatccgcagggggaggaggagctcgacacgccgatgaggagggagcggctgatggaggcg
gcgtggcccggaatggcgtatggcgagtccggcgagccggagccgtccttgatcccttac
cagattttgagttggcaacctcgtgcactatattttccacaatttgcaacatcgcaacag
tgcgaaaatattgtaaaaactgctaaacaaaggcttatgccatcgacattggctttaagg
aaaggagaaactgaggagagcaccaaaggaataaggacaagctcaggcacatttctaagt
tctgatgaagatccaaccggaacccttgctgaagttgaaaagaagattgcaaaggccacc
atgatccctagacatcatggggagccctttaatatcctgcgctatgagattggacagagg
tatgcttcgcattatgacgcattcgacccagctcagtatggtccacaaaaaagtcaaagg
gtcgcgtctttcttgctttatctcacggatgttgaagaaggcggagaaaccatgttccca
tatgagaacggggaaaacatggatatagggtatgactatgaaaagtgcattggcttaaag
gttaaaccaaggaagggtgatggtctcttgttttactcccttatggtaaatggcaccatt
gatccgacatctcttcatggtagctgcccagtgatcaaaggagaaaaatgggtcgccaca
aaatggattagagacaagaggcaagaaaatttgctgctatgggtgacctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334477
Entry
4334477           CDS       T01015                                 
Name
(RefSeq) probable prolyl 4-hydroxylase 6
  KO
K00472  prolyl 4-hydroxylase [EC:1.14.11.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4334477
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.2  procollagen-proline 4-dioxygenase
     4334477
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy ShK
Other DBs
NCBI-GeneID: 4334477
NCBI-ProteinID: XP_015627937
UniProt: Q84T04 Q0DML4
LinkDB
Position
3:complement(33522564..33524976)
AA seq 299 aa
MAPLRTLVIFLLLLLALVPALSRPDGGGGGFYDPARVTQLSWRPRAFLYSGFLSHDECDH
LVNLAKGRMEKSMVADNDSGKSIMSQVRTSSGTFLSKHEDDIVSGIEKRVAAWTFLPEEN
AESIQILHYELGQKYDAHFDYFHDKNNLKRGGHRVATVLMYLTDVKKGGETVFPNAAGRH
LQLKDETWSDCARSGLAVKPKKGDALLFFSLHVNATTDPASLHGSCPVIEGEKWSATKWI
HVRSFDNPPDVSLDLPCSDENERCTRWAAVGECYRNPKYMVGTKDSLGFCRKSCGVCDA
NT seq 900 nt   +upstreamnt  +downstreamnt
atggcgcccctccgaacactcgttatcttcctcctcctcctcctcgcgctcgtcccggca
ctctcgcgcccggatggcggcggcggcggcttctatgacccggcgcgcgtcacccagcta
tcctggcgccccagggcgttcctgtacagcggcttcctctcgcacgacgagtgcgaccac
ctcgtcaatctggcgaaggggaggatggagaagtcgatggttgcagacaatgattccggc
aagagtatcatgagccaggtgcgcaccagctccggcaccttcttatcgaagcacgaggac
gacattgtttctggaattgaaaagcgtgtagctgcttggacatttcttcctgaagaaaac
gccgagtcaattcagattctgcattatgagcttggtcagaagtatgatgcccacttcgat
tatttccatgacaagaacaaccttaagcgtgggggtcatcgagtcgccactgtgcttatg
tacttgaccgatgtcaaaaagggtggagagactgtatttccaaatgctgcgggaaggcat
ttacaactcaaggatgaaacttggtctgattgtgcaagatctggcctggcagtgaagcca
aagaaaggcgatgcgctactgttcttcagtctccatgttaacgcgacaacggatccagcc
agtcttcatggaagctgtccggtgatcgaaggcgagaaatggtctgcaacgaaatggatc
catgtcagatcatttgataatcctccggatgtaagcctggatttgccgtgttccgatgaa
aacgagcgctgcacgagatgggctgctgttggagagtgttacaggaacccaaaatacatg
gttggcaccaaggattcgctcggattctgccgcaagagctgcggggtttgcgatgcttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4335530
Entry
4335530           CDS       T01015                                 
Name
(RefSeq) prolyl 4-hydroxylase 1
  KO
K00472  prolyl 4-hydroxylase [EC:1.14.11.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4335530
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.2  procollagen-proline 4-dioxygenase
     4335530
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy
Other DBs
NCBI-GeneID: 4335530
NCBI-ProteinID: XP_015636600
UniProt: A3ASL4 Q7XNS6
LinkDB
Position
4:16449478..16456534
AA seq 267 aa
MGMARARARRLLPLLTFVTLGMILGSLLQLAFFRRIDDHSNVTHLENDQEAAFLRLGLVK
PEVISWSPRIIVFHNFLSSEECDYLRSIARPRLQISTVVDVATGKGVKSNVRTSSGMFVS
SEERKLPVIQSIEKRISVYSQIPEENGELIQVLRYEPSQYYRPHHDYFSDTFNIKRGGQR
VATMLMYLTDGVEGGETHFPQAGDGECSCGGKMVKGLCVKPNKGDAVLFWSMGLDGETDS
NSIHGGCPVLEGEKWSATKWMRQKEFV
NT seq 804 nt   +upstreamnt  +downstreamnt
atggggatggcgcgggcgcgggcgcggcggttgctgccgctgctcaccttcgtcacgctc
ggcatgatcctaggctctttacttcagttagcgtttttccgccggatagatgatcactca
aatgtaacacatttggagaatgatcaagaagcagcttttctccgtctaggattggtgaag
cctgaagtcatcagctggtcacctcggataattgtcttccataactttcttagttctgag
gagtgtgattatctaagatcaattgctagaccaagactacagatttccactgtagtggat
gtcgcaacaggaaagggtgttaaaagtaatgtccgtacaagttctggtatgtttgtgagt
tctgaagaaagaaagttaccagtcattcagtctatagagaagaggatttctgtgtactct
cagatacctgaagaaaatggagaactcatccaagtattacggtatgaaccaagccaatat
tacaggccacatcatgattacttttctgacactttcaacatcaaacgtgggggccagcga
gttgcaacaatgttgatgtatttgactgatggtgttgaagggggtgaaacccattttcct
caggcaggagatggtgaatgtagctgtggcgggaagatggtcaaaggattatgtgtcaag
ccaaacaaaggagatgctgtgctattttggagcatgggactcgatggtgaaacagactca
aacagcattcatggtgggtgccctgttctggaaggggagaaatggtcagctacgaaatgg
atgaggcaaaaagaatttgtttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342642
Entry
4342642           CDS       T01015                                 
Name
(RefSeq) probable prolyl 4-hydroxylase 6
  KO
K00472  prolyl 4-hydroxylase [EC:1.14.11.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4342642
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.2  procollagen-proline 4-dioxygenase
     4342642
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy ShK DUF295
Other DBs
NCBI-GeneID: 4342642
NCBI-ProteinID: XP_015644972
UniProt: Q0D7Z6 A0A0P0X3D5
LinkDB
Position
7:complement(5116523..5119153)
AA seq 319 aa
MVAVVMMAMRKRMRGALLALALLLTATAVVPLLLLGEAGDDGVGAVAAAPPFNASRVRAV
SWRPRVFVYKGFLSDDECDHLVKLGKRKMQRSMVADNKSGKSVMSEVRTSSGMFLDKRQD
PVVSRIEKRIAAWTFLPEENAENIQILRYEHGQKYEPHFDYFHDKVNQALGGHRYATVLM
YLSTVEKGGETVFPNAEGWENQPKDDTFSECAQKGLAVKPVKGDTVLFFSLHIDGVPDPL
SLHGSCPVIEGEKWSAPKWIRIRSYEHPPVSKVTEGCSDNSARCAKWAEAGECEKNPVYM
VGAEGLPGNCRKSCGVCDS
NT seq 960 nt   +upstreamnt  +downstreamnt
atggtggcggtggtgatgatggcgatgaggaagaggatgcgcggcgcgctgctggcgctc
gcgctgctgctcaccgcgacggccgtcgtgccgctgctcctcctcggagaggccggggac
gacggcgtcggggccgtcgccgccgcgccgccgttcaacgcgtcccgcgtcagggcggtg
tcgtggaggcccagggtcttcgtctacaaggggttcctctccgacgacgagtgcgaccac
ctcgtcaagctggggaagaggaagatgcagaggtcgatggtggcggacaacaagtccggc
aagagcgtcatgagcgaggtgcggaccagctccggcatgttcctcgacaagcgccaggat
ccagtggtgagcaggattgaaaaaagaattgcagcatggacctttcttcctgaagaaaat
gctgagaacattcagatactccgatacgagcatgggcagaagtatgagccgcactttgat
tatttccatgacaaggtcaatcaagcactgggaggccaccgttacgcgacggtgctcatg
tatttgtccactgtcgagaagggaggcgagactgtgttccccaatgctgaggggtgggaa
aatcagcccaaggatgacactttctctgaatgtgcacaaaaaggattggcagtgaaacca
gttaaaggcgacacggtgctcttctttagccttcatatcgatggcgtaccggacccgctc
agcctccatgggagctgcccagtgatagaaggtgaaaaatggtctgcaccaaagtggatc
cgtatcaggtcctatgagcatcctcctgtctcaaaggtgacagaaggatgctccgacaac
agtgcacgttgcgcgaaatgggctgaagctggagaatgcgagaagaacccggtatacatg
gtaggtgccgagggtttgcccggcaattgtcggaagagttgtggcgtttgtgattcctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348615
Entry
4348615           CDS       T01015                                 
Name
(RefSeq) probable prolyl 4-hydroxylase 7
  KO
K00472  prolyl 4-hydroxylase [EC:1.14.11.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00330  Arginine and proline metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    4348615
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.2  procollagen-proline 4-dioxygenase
     4348615
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 2OG-FeII_Oxy ShK
Other DBs
NCBI-GeneID: 4348615
NCBI-ProteinID: XP_015614525
UniProt: B9G5Q6 Q109P7
LinkDB
Position
10:complement(14428239..14432382)
AA seq 308 aa
MAALSSRRRHGSLRLLAVALLVLAGVASSAAAAGSGRGAFDPSRVVQLSWRPRAFLHKGF
LTDAECEHLISLAKDKLEKSMVADNESGKSVMSEVRTSSGMFLEKKQDEVVARIEERIAA
WTFLPPDNGESIQILHYQNGEKYEPHYDYFHDKNNQALGGHRIATVLMYLSDVGKGGETI
FPEAEGKLLQPKDDTWSDCAKNGYAVKPVKGDALLFFSLHPDATTDSDSLHGSCPVIEGQ
KWSATKWIHVRSFDISVKQGASTDGCEDENVLCPQWAAVGECAKNPNYMVGTNEAPGFCR
KSCNVCAQ
NT seq 927 nt   +upstreamnt  +downstreamnt
atggccgctctcagctcgcgccgccgccatggcagcctccgcctcctcgccgtggccctc
ctggtgctcgccggagtggcctcctccgccgccgcggcggggagcggccgcggcgcattt
gacccatcccgcgtcgtgcagctctcgtggcgccccagggcgttcctgcacaaggggttc
ctgacggacgcggagtgcgagcacctgatctcgctggcgaaggacaagctggagaagtcg
atggtggcggacaacgagtccgggaagagcgtcatgagcgaggtgcggaccagctccggc
atgttcctcgagaagaagcaggacgaagttgtagctaggatagaggagaggattgcagct
tggacgttccttccaccagataatggcgaatccattcaaatattacattatcagaatggc
gagaagtatgagccacactatgattacttccatgacaaaaataatcaagctcttggagga
catcggatcgccactgtgctcatgtacctttcagacgttgggaaggggggagagaccatc
tttccagaagcagaggggaagttattacaacccaaggatgatacatggtctgactgtgct
aaaaatggatatgcagtaaaaccggtaaagggtgatgcccttctgttcttcagtctccac
cccgatgcaacaacagactctgacagcctgcacgggagctgcccggtcattgaaggtcag
aagtggtccgcaactaaatggatccatgtgaggtccttcgacatctctgtcaagcaggga
gcttccactgacgggtgcgaggatgagaacgtcctctgcccccagtgggctgcagtaggg
gagtgtgccaagaatccgaactacatggtgggtaccaatgaagcacctggcttctgccgg
aagagctgcaatgtgtgtgcacagtaa

DBGET integrated database retrieval system