Oryza sativa japonica (Japanese rice): 107278737 Help Entry 107278737         CDS       T01015                                  Name (RefSeq) SKP1-like protein 4   KO K03094   S-phase kinase-associated protein 1 Organism osa  Oryza sativa japonica (Japanese rice) Pathway osa03083   Polycomb repressive complex osa04120   Ubiquitin mediated proteolysis osa04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:osa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107278737    04120 Ubiquitin mediated proteolysis     107278737   09126 Chromosome    03083 Polycomb repressive complex     107278737  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:osa04131]     107278737    04121 Ubiquitin system [BR:osa04121]     107278737    03036 Chromosome and associated proteins [BR:osa03036]     107278737 Membrane trafficking [BR:osa04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     107278737 Ubiquitin system [BR:osa04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      107278737    Cul7 complex      107278737 Chromosome and associated proteins [BR:osa03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      107278737   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      107278737 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ DUF7362 Spt20_SEP Motif Other DBs NCBI-GeneID:  107278737 NCBI-ProteinID:  XP_015645851 UniProt:  A3BGJ0 LinkDB All DBs Position 7:2298226..2298699 Genome browser AA seq 157 aa AA seqDB search MIILISADGKRFEVTEAVASQSQLISNMIEDDCTENGVRLPNVDGDILTMVVDYCNMHAG DAAAAGDTMKASSTEEELKKFDAELVQALENPVLFKLILAANFLNIKSLLDMTCQRVADM MSGKTPEQMRETFSIENDFTPEEEAAIRQENAWAFDD NT seq 474 nt NT seq  +upstreamnt  +downstreamnt atgatcatcctgatcagcgccgacgggaaacgcttcgaggtgacggaggcggtggcgagc caatcgcagctgatatccaacatgatcgaggacgattgcacggagaacggggtgcgtctc cccaacgtcgacggcgacatcctcaccatggtcgtcgactactgcaacatgcacgccggc gacgccgccgccgccggcgacaccatgaaagcatcaagcacggaggaggagctgaagaag ttcgacgccgagttggtgcaagccctcgagaatccggtgctgttcaagctgatcttggcg gccaatttcttgaacatcaagagcttgctggacatgacgtgccagcgcgtggcggacatg atgtccggcaagacgccggagcagatgagggagacgttttcgatcgagaacgacttcacg ccggaggaggaggcggcgattcgccaggagaacgcctgggccttcgacgactag

DBGET integrated database retrieval system