KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107278854
Entry
107278854         CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L2, chloroplastic
  KO
K02886  large subunit ribosomal protein L2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107278854
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    107278854
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    107278854
  Bacteria
    107278854
  Archaea
    107278854
SSDB
Motif
Pfam: Ribosomal_L2_C Ribosomal_L2
Other DBs
NCBI-GeneID: 107278854
NCBI-ProteinID: XP_015611184
LinkDB
Position
9:14505379..14509920
AA seq 284 aa
MESNTQRILNNTAKHLYKTPIPSTRKGTIDRQVKSNPRNNLIHGRHRCGKGRNSRGIITA
RHRGGGHKRLYRKIDFRRNQKDISGRIVTIEYDPNRNAYICLIHYGDGEKGYILHPRGAI
IGDTIVSGTKVPISMGNALPLTDMPLGTAIHNIEITRGRGGQLARAAGAVAKLIAKEGKS
ATLRLPSGEVRLVSQNCLATVGQVGNVGVNQKSLGRAGSKCWLGKRPVVRGVVMNPVDHP
HGGGEGKAPIGRKKPTTPWGYPALGRRTRKRKKYSDSFILRRRK
NT seq 855 nt   +upstreamnt  +downstreamnt
atggaatcaaatacgcagagaatacttaataatacggcgaaacatttatacaaaacacct
atcccgagcacacgcaagggaaccatagataggcaagtgaaatccaatccacgaaataat
ttgatccatggacggcaccgttgtggtaaaggtcgtaattccagaggaatcattaccgca
aggcatagagggggaggtcataagcgcctataccgtaaaatcgattttcgacggaatcaa
aaagacatatctggtagaatcgtaaccatagaatacgaccctaatcgaaatgcgtacatt
tgtctcatacactatggggatggtgagaagggatatattttacatcccagaggggctata
attggagatactattgtttctggtacaaaagttcctatatcaatgggaaatgccctacct
ttgaccgatatgcccttaggcacggccatacataacatagaaatcacacgtggaaggggt
gggcaattagctagagcagcaggtgctgtagcgaaactgattgcaaaagaaggtaaatcg
gccactttaagattaccatctggggaggtccgtttggtatcccaaaactgcttagcaaca
gtcggacaagtgggtaatgttggggtgaaccaaaaaagtttgggtagagccgggtctaag
tgttggctaggtaaacgccccgtagtaagaggggtagttatgaaccctgtggaccacccc
catgggggcggtgaagggaaagcccccattggtagaaaaaaacccacaaccccttggggt
tatcctgcgcttggaagaagaactaggaaaaggaaaaaatatagtgatagttttattctt
cgtcgccgtaagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107280605
Entry
107280605         CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L2, chloroplastic-like
  KO
K02886  large subunit ribosomal protein L2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107280605
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    107280605
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    107280605
  Bacteria
    107280605
  Archaea
    107280605
SSDB
Motif
Pfam: Ribosomal_L2_C Ribosomal_L2
Other DBs
NCBI-GeneID: 107280605
NCBI-ProteinID: XP_015634745
LinkDB
Position
4:complement(9137326..9139410)
AA seq 290 aa
MAEWLKRPTHNWRILNNTAKHLYKTPIPSTRKGTIDRQVKSNPRNNLIHGRHRCGKGRNS
RGIITARHRGGGHKRLYRKIDFRRNQKDISGRIVTIEYDPNRNAYICLIHYGDGEKGYIL
HPRGAIIGDTIVSGTKVPISMGNALPLTDMPLGTAIHNIEITRGRGGQLARAAGAVAKLI
AKEGKSATLRLPSGEVRLVSQNCLATVGQVGNVGVNQKSLGRAGSKCWLGKRPVVRGVVM
NPVDHPHGGGEGKAPIGRKKPTTPWGYPALGRRTRKRKKYSDSFILRRRK
NT seq 873 nt   +upstreamnt  +downstreamnt
atggctgaatggttaaagcgcccaactcataattggagaatacttaataatacggcgaaa
catttatacaaaacacctatcccgagcacacgcaagggaaccatagataggcaagtgaaa
tccaatccacgaaataatttgatccatggacggcaccgttgtggtaaaggtcgtaattcc
agaggaatcattaccgcaaggcatagagggggaggtcataagcgcctataccgtaaaatc
gattttcgacggaatcaaaaagacatatctggtagaatcgtaaccatagaatacgaccct
aatcgaaatgcgtacatttgtctcatacactatggggatggtgagaagggatatatttta
catcccagaggggctataattggagatactattgtttctggtacaaaagttcctatatca
atgggaaatgccctacctttgaccgatatgcccttaggcacggccatacataacatagaa
atcacacgtggaaggggtgggcaattagctagagcagcaggtgctgtagcgaaactgatt
gcaaaagaaggtaaatcggccactttaagattaccatctggggaggtccgtttggtatcc
caaaactgcttagcaacagtcggacaagtgggtaatgttggggtgaaccaaaaaagtttg
ggtagagccgggtctaagtgttggctaggtaaacgccccgtagtaagaggggtagttatg
aaccctgtggaccacccccatgggggcggtgaagggaaagcccccattggtagaaaaaaa
cccacaaccccttggggttatcctgcgcttggaagaagaactaggaaaaggaaaaaatat
agtgatagttttattcttcgtcgccgtaagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107280606
Entry
107280606         CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L2, chloroplastic-like
  KO
K02886  large subunit ribosomal protein L2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107280606
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    107280606
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    107280606
  Bacteria
    107280606
  Archaea
    107280606
SSDB
Motif
Pfam: Ribosomal_L2_C Ribosomal_L2
Other DBs
NCBI-GeneID: 107280606
NCBI-ProteinID: XP_015634746
LinkDB
Position
4:9152165..9156435
AA seq 290 aa
MAEWLKRPTHNWRILNNTAKHLYKTPIPSTRKGTIDRQVKSNPRNNLIHGRHRCGKGRNS
RGIITARHRGGGHKRLYRKIDFRRNQKDISGRIVTIEYDPNRNAYICLIHYGDGEKGYIL
HPRGAIIGDTIVSGTKVPISMGNALPLTDMPLGTAIHNIEITRGRGGQLARAAGAVAKLI
AKEGKSATLRLPSGEVRLVSQNCLATVGQVGNVGVNQKSLGRAGSKCWLGKRPVVRGVVM
NPVDHPHGGGEGKAPIGRKKPTTPWGYPALGRRTRKRKKYSDSFILRRRK
NT seq 873 nt   +upstreamnt  +downstreamnt
atggctgaatggttaaagcgcccaactcataattggagaatacttaataatacggcgaaa
catttatacaaaacacctatcccgagcacacgcaagggaaccatagataggcaagtgaaa
tccaatccacgaaataatttgatccatggacggcaccgttgtggtaaaggtcgtaattcc
agaggaatcattaccgcaaggcatagagggggaggtcataagcgcctataccgtaaaatc
gattttcgacggaatcaaaaagacatatctggtagaatcgtaaccatagaatacgaccct
aatcgaaatgcgtacatttgtctcatacactatggggatggtgagaagggatatatttta
catcccagaggggctataattggagatactattgtttctggtacaaaagttcctatatca
atgggaaatgccctacctttgaccgatatgcccttaggcacggccatacataacatagaa
atcacacgtggaaggggtgggcaattagctagagcagcaggtgctgtagcgaaactgatt
gcaaaagaaggtaaatcggccactttaagattaccatctggggaggtccgtttggtatcc
caaaactgcttagcaacagtcggacaagtgggtaatgttggggtgaaccaaaaaagtttg
ggtagagccgggtctaagtgttggctaggtaaacgccccgtagtaagaggggtagttatg
aaccctgtggaccacccccatgggggcggtgaagggaaagcccccattggtagaaaaaaa
cccacaaccccttggggttatcctgcgcttggaagaagaactaggaaaaggaaaaaatat
agtgatagttttattcttcgtcgccgtaagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107281610
Entry
107281610         CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L2, chloroplastic-like
  KO
K02886  large subunit ribosomal protein L2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107281610
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    107281610
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    107281610
  Bacteria
    107281610
  Archaea
    107281610
SSDB
Motif
Pfam: Ribosomal_L2_C Ribosomal_L2
Other DBs
NCBI-GeneID: 107281610
NCBI-ProteinID: XP_015645963
LinkDB
Position
7
AA seq 290 aa
MAEWLKRPTHNWRILNNTAKHLYKTPIPSTRKGTIDRQVKSNPRNNLIHGRHRCGKGRNS
RGIITARHRGGGHKRLYRKIDFRRNQKDISGRIVTIEYDPNRNAYICLIHYGDGEKGYIL
HPRGAIIGDTIVSGTKVPISMGNALPLTDMPLGTAIHNIEITRGRGGQLARAAGAVAKLI
AKEGKSATLRLPSGEVRLVSQNCLATVGQVGNVGVNQKSLGRAGSKCWLGKRPVVRGVVM
NPVDHPHGGGEGKAPIGRKKPTTPWGYPALGRRTRKRKKYSDSFILRRRK
NT seq 873 nt   +upstreamnt  +downstreamnt
atggctgaatggttaaagcgcccaactcataattggagaatacttaataatacggcgaaa
catttatacaaaacacctatcccgagcacacgcaagggaaccatagataggcaagtgaaa
tccaatccacgaaataatttgatccatggacggcaccgttgtggtaaaggtcgtaattcc
agaggaatcattaccgcaaggcatagagggggaggtcataagcgcctataccgtaaaatc
gattttcgacggaatcaaaaagacatatctggtagaatcgtaaccatagaatacgaccct
aatcgaaatgcgtacatttgtctcatacactatggggatggtgagaagggatatatttta
catcccagaggggctataattggagatactattgtttctggtacaaaagttcctatatca
atgggaaatgccctacctttgaccgatatgcccttaggcacggccatacataacatagaa
atcacacgtggaaggggtgggcaattagctagagcagcaggtgctgtagcgaaactgatt
gcaaaagaaggtaaatcggccactttaagattaccatctggggaggtccgtttggtatcc
caaaactgcttagcaacagtcggacaagtgggtaatgttggggtgaaccaaaaaagtttg
ggtagagccgggtctaagtgttggctaggtaaacgccccgtagtaagaggggtagttatg
aaccctgtggaccacccccatgggggcggtgaagggaaagcccccattggtagaaaaaaa
cccacaaccccttggggttatcctgcgcttggaagaagaactaggaaaaggaaaaaatat
agtgatagttttattcttcgtcgccgtaagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107281913
Entry
107281913         CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L2, chloroplastic-like
  KO
K02886  large subunit ribosomal protein L2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107281913
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    107281913
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    107281913
  Bacteria
    107281913
  Archaea
    107281913
SSDB
Motif
Pfam: Ribosomal_L2_C Ribosomal_L2
Other DBs
NCBI-GeneID: 107281913
NCBI-ProteinID: XP_015649234
LinkDB
Position
8:9260720..9264980
AA seq 290 aa
MAEWLKRPTHNWRILNNTAKHLYKTPIPSTRKGTIDRQVKSNPRNNLIHGRHRCGKGRNS
RGIITARHRGGGHKRLYRKIDFRRNQKDISGRIVTIEYDPNRNAYICLIHYGDGEKGYIL
HPRGAIIGDTIVYGTKVPISMGNALPLTDMPLGTAIHNIEITRGRGGQLARAAGAVAKLI
AKEGKSATLRLPSGEVRLVSQNCLATVGQVGNVGVNQKSLGRAGSKCWLGKRPVVRGVVM
NPVDHPHGGGEGKAPIGRKKPTTPWGYPALGRRTRKRKKYSDSFILRRRK
NT seq 873 nt   +upstreamnt  +downstreamnt
atggctgaatggttaaagcgcccaactcataattggagaatacttaataatacggcgaaa
catttatacaaaacacctatcccgagcacacgcaagggaaccatagataggcaagtgaaa
tccaatccacgaaataatttgatccatggacggcaccgttgtggtaaaggtcgtaattcc
agaggaatcattaccgcaaggcatagagggggaggtcataagcgcctataccgtaaaatc
gattttcgacggaatcaaaaagacatatctggtagaatcgtaaccatagaatacgaccct
aatcgaaatgcgtacatttgtctcatacactatggggatggtgagaagggatatatttta
catcccagaggggctataattggagatactattgtttatggtacaaaagttcctatatca
atgggaaatgccctacctttgaccgatatgcccttaggcacggccatacataacatagaa
atcacacgtggaaggggtgggcaattagctagagcagcaggtgctgtagcgaaactgatt
gcaaaagaaggtaaatcggccactttaagattaccatctggggaggtccgtttggtatcc
caaaactgcttagcaacagtcggacaagtgggtaatgttggggtgaaccaaaaaagtttg
ggtagagccgggtctaagtgttggctaggtaaacgccccgtagtaagaggggtagttatg
aaccctgtggaccacccccatgggggcggtgaagggaaagcccccattggtagaaaaaaa
cccacaaccccttggggttatcctgcgcttggaagaagaactaggaaaaggaaaaaatat
agtgatagttttattcttcgtcgccgtaagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131421
Entry
3131421           CDS       T01015                                 
Symbol
rpl2, OrsajCp069
Name
(RefSeq) ribosomal protein L2
  KO
K02886  large subunit ribosomal protein L2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    3131421 (rpl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    3131421 (rpl2)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    3131421 (rpl2)
  Bacteria
    3131421 (rpl2)
  Archaea
    3131421 (rpl2)
SSDB
Motif
Pfam: Ribosomal_L2_C Ribosomal_L2
Other DBs
NCBI-GeneID: 3131421
NCBI-ProteinID: NP_039427
UniProt: P0C497
LinkDB
Position
Pltd:complement(81180..82664)
AA seq 273 aa
MAKHLYKTPIPSTRKGTIDRQVKSNPRNNLIHGRHRCGKGRNSRGIITARHRGGGHKRLY
RKIDFRRNQKDISGRIVTIEYDPNRNAYICLIHYGDGEKGYILHPRGAIIGDTIVSGTKV
PISMGNALPLTDMPLGTAIHNIEITRGRGGQLARAAGAVAKLIAKEGKSATLRLPSGEVR
LVSQNCLATVGQVGNVGVNQKSLGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGKAPIG
RKKPTTPWGYPALGRRTRKRKKYSDSFILRRRK
NT seq 822 nt   +upstreamnt  +downstreamnt
acggcgaaacatttatacaaaacacctatcccgagcacacgcaagggaaccatagatagg
caagtgaaatccaatccacgaaataatttgatccatggacggcaccgttgtggtaaaggt
cgtaattccagaggaatcattaccgcaaggcatagagggggaggtcataagcgcctatac
cgtaaaatcgattttcgacggaatcaaaaagacatatctggtagaatcgtaaccatagaa
tacgaccctaatcgaaatgcgtacatttgtctcatacactatggggatggtgagaaggga
tatattttacatcccagaggggctataattggagatactattgtttctggtacaaaagtt
cctatatcaatgggaaatgccctacctttgaccgatatgcccttaggcacggccatacat
aacatagaaatcacacgtggaaggggtgggcaattagctagagcagcaggtgctgtagcg
aaactgattgcaaaagaaggtaaatcggccactttaagattaccatctggggaggtccgt
ttggtatcccaaaactgcttagcaacagtcggacaagtgggtaatgttggggtgaaccaa
aaaagtttgggtagagccgggtctaagtgttggctaggtaaacgccccgtagtaagaggg
gtagttatgaaccctgtggaccacccccatgggggcggtgaagggaaagcccccattggt
agaaaaaaacccacaaccccttggggttatcctgcgcttggaagaagaactaggaaaagg
aaaaaatatagtgatagttttattcttcgtcgccgtaagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131424
Entry
3131424           CDS       T01015                                 
Symbol
rpl2, OrsajCp109
Name
(RefSeq) ribosomal protein L2
  KO
K02886  large subunit ribosomal protein L2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    3131424 (rpl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    3131424 (rpl2)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    3131424 (rpl2)
  Bacteria
    3131424 (rpl2)
  Archaea
    3131424 (rpl2)
SSDB
Motif
Pfam: Ribosomal_L2_C Ribosomal_L2
Other DBs
NCBI-GeneID: 3131424
NCBI-ProteinID: NP_039463
UniProt: P0C497
LinkDB
Position
Pltd:132454..133938
AA seq 273 aa
MAKHLYKTPIPSTRKGTIDRQVKSNPRNNLIHGRHRCGKGRNSRGIITARHRGGGHKRLY
RKIDFRRNQKDISGRIVTIEYDPNRNAYICLIHYGDGEKGYILHPRGAIIGDTIVSGTKV
PISMGNALPLTDMPLGTAIHNIEITRGRGGQLARAAGAVAKLIAKEGKSATLRLPSGEVR
LVSQNCLATVGQVGNVGVNQKSLGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGKAPIG
RKKPTTPWGYPALGRRTRKRKKYSDSFILRRRK
NT seq 822 nt   +upstreamnt  +downstreamnt
acggcgaaacatttatacaaaacacctatcccgagcacacgcaagggaaccatagatagg
caagtgaaatccaatccacgaaataatttgatccatggacggcaccgttgtggtaaaggt
cgtaattccagaggaatcattaccgcaaggcatagagggggaggtcataagcgcctatac
cgtaaaatcgattttcgacggaatcaaaaagacatatctggtagaatcgtaaccatagaa
tacgaccctaatcgaaatgcgtacatttgtctcatacactatggggatggtgagaaggga
tatattttacatcccagaggggctataattggagatactattgtttctggtacaaaagtt
cctatatcaatgggaaatgccctacctttgaccgatatgcccttaggcacggccatacat
aacatagaaatcacacgtggaaggggtgggcaattagctagagcagcaggtgctgtagcg
aaactgattgcaaaagaaggtaaatcggccactttaagattaccatctggggaggtccgt
ttggtatcccaaaactgcttagcaacagtcggacaagtgggtaatgttggggtgaaccaa
aaaagtttgggtagagccgggtctaagtgttggctaggtaaacgccccgtagtaagaggg
gtagttatgaaccctgtggaccacccccatgggggcggtgaagggaaagcccccattggt
agaaaaaaacccacaaccccttggggttatcctgcgcttggaagaagaactaggaaaagg
aaaaaatatagtgatagttttattcttcgtcgccgtaagtaa

DBGET integrated database retrieval system