KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107278968
Entry
107278968         CDS       T01015                                 
Name
(RefSeq) 30S ribosomal protein S7, chloroplastic
  KO
K02992  small subunit ribosomal protein S7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107278968
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    107278968
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    107278968
  Bacteria
    107278968
  Archaea
    107278968
SSDB
Motif
Pfam: Ribosomal_S7
Other DBs
NCBI-GeneID: 107278968
NCBI-ProteinID: XP_015612724
UniProt: P0C491 A0A0K0LR14 Q6YTM6
LinkDB
Position
10:complement(10894420..10897582)
AA seq 156 aa
MSRRGTAEKRTAKSDPIFRNRLVNMVVNRIMKDGKKSLAYQILYRAVKKIQQKTETNPLL
VLRQAIRRVTPNIGVKTRRNKKGSTRKVPIEIGSKQGRALAIRWLLEASQKRPGRNMAFK
LSSELVDAAKGGGGAIRKKEATHRMAEANRALAHFR
NT seq 471 nt   +upstreamnt  +downstreamnt
atgtcacgtcgaggtactgcagaaaaaagaactgcaaaatccgatccaatttttcgtaat
cgattagttaacatggtggttaaccgtattatgaaagacggaaaaaaatcattggcttat
caaattctctatcgagccgtgaaaaagattcaacaaaagacagaaacaaatccactattg
gttttacgtcaagcaatacgtagagtaactcccaatataggagtaaaaacaagacgtaat
aaaaaaggatcgacgcggaaagttccgattgaaataggatctaaacaaggaagagcactt
gccattcgttggttattagaagcatcccaaaagcgtccgggtcgaaatatggctttcaaa
ttaagttccgaattagtagatgctgccaaagggggtgggggtgccatacgcaaaaaggaa
gcgactcatagaatggcagaggcaaatagagctcttgcacattttcgttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107280672
Entry
107280672         CDS       T01015                                 
Name
(RefSeq) 30S ribosomal protein S7, chloroplastic
  KO
K02992  small subunit ribosomal protein S7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107280672
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    107280672
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    107280672
  Bacteria
    107280672
  Archaea
    107280672
SSDB
Motif
Pfam: Ribosomal_S7
Other DBs
NCBI-GeneID: 107280672
NCBI-ProteinID: XP_015635025
UniProt: P0C491 A0A0K0LR14 Q6YTM6
LinkDB
Position
4:complement(9167121..9170270)
AA seq 156 aa
MSRRGTAEKRTAKSDPIFRNRLVNMVVNRIMKDGKKSLAYQILYRAVKKIQQKTETNPLL
VLRQAIRRVTPNIGVKTRRNKKGSTRKVPIEIGSKQGRALAIRWLLEASQKRPGRNMAFK
LSSELVDAAKGGGGAIRKKEATHRMAEANRALAHFR
NT seq 471 nt   +upstreamnt  +downstreamnt
atgtcacgtcgaggtactgcagaaaaaagaactgcaaaatccgatccaatttttcgtaat
cgattagttaacatggtggttaaccgtattatgaaagacggaaaaaaatcattggcttat
caaattctctatcgagccgtgaaaaagattcaacaaaagacagaaacaaatccactattg
gttttacgtcaagcaatacgtagagtaactcccaatataggagtaaaaacaagacgtaat
aaaaaaggatcgacgcggaaagttccgattgaaataggatctaaacaaggaagagcactt
gccattcgttggttattagaagcatcccaaaagcgtccgggtcgaaatatggctttcaaa
ttaagttccgaattagtagatgctgccaaagggggtgggggtgccatacgcaaaaaggaa
gcgactcatagaatggcagaggcaaatagagctcttgcacattttcgttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107281766
Entry
107281766         CDS       T01015                                 
Name
(RefSeq) 30S ribosomal protein S7, chloroplastic
  KO
K02992  small subunit ribosomal protein S7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107281766
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    107281766
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    107281766
  Bacteria
    107281766
  Archaea
    107281766
SSDB
Motif
Pfam: Ribosomal_S7
Other DBs
NCBI-GeneID: 107281766
NCBI-ProteinID: XP_015646874
UniProt: P0C491 A0A0K0LR14 Q6YTM6
LinkDB
Position
7:14236868..14237507
AA seq 156 aa
MSRRGTAEKRTAKSDPIFRNRLVNMVVNRIMKDGKKSLAYQILYRAVKKIQQKTETNPLL
VLRQAIRRVTPNIGVKTRRNKKGSTRKVPIEIGSKQGRALAIRWLLEASQKRPGRNMAFK
LSSELVDAAKGGGGAIRKKEATHRMAEANRALAHFR
NT seq 471 nt   +upstreamnt  +downstreamnt
atgtcacgtcgaggtactgcagaaaaaagaactgcaaaatccgatccaatttttcgtaat
cgattagttaacatggtggttaaccgtattatgaaagacggaaaaaaatcattggcttat
caaattctctatcgagccgtgaaaaagattcaacaaaagacagaaacaaatccactattg
gttttacgtcaagcaatacgtagagtaactcccaatataggagtaaaaacaagacgtaat
aaaaaaggatcgacgcggaaagttccgattgaaataggatctaaacaaggaagagcactt
gccattcgttggttattagaagcatcccaaaagcgtccgggtcgaaatatggctttcaaa
ttaagttccgaattagtagatgctgccaaagggggtgggggtgccatacgcaaaaaggaa
gcgactcatagaatggcagaggcaaatagagctcttgcacattttcgttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107282054
Entry
107282054         CDS       T01015                                 
Name
(RefSeq) 30S ribosomal protein S7, chloroplastic
  KO
K02992  small subunit ribosomal protein S7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107282054
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    107282054
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    107282054
  Bacteria
    107282054
  Archaea
    107282054
SSDB
Motif
Pfam: Ribosomal_S7
Other DBs
NCBI-GeneID: 107282054
NCBI-ProteinID: XP_015649752
UniProt: P0C491 A0A0K0LR14 Q6YTM6
LinkDB
Position
8:9254156..9255570
AA seq 156 aa
MSRRGTAEKRTAKSDPIFRNRLVNMVVNRIMKDGKKSLAYQILYRAVKKIQQKTETNPLL
VLRQAIRRVTPNIGVKTRRNKKGSTRKVPIEIGSKQGRALAIRWLLEASQKRPGRNMAFK
LSSELVDAAKGGGGAIRKKEATHRMAEANRALAHFR
NT seq 471 nt   +upstreamnt  +downstreamnt
atgtcacgtcgaggtactgcagaaaaaagaactgcaaaatccgatccaatttttcgtaat
cgattagttaacatggtggttaaccgtattatgaaagacggaaaaaaatcattggcttat
caaattctctatcgagccgtgaaaaagattcaacaaaagacagaaacaaatccactattg
gttttacgtcaagcaatacgtagagtaactcccaatataggagtaaaaacaagacgtaat
aaaaaaggatcgacgcggaaagttccgattgaaataggatctaaacaaggaagagcactt
gccattcgttggttattagaagcatcccaaaagcgtccgggtcgaaatatggctttcaaa
ttaagttccgaattagtagatgctgccaaagggggtgggggtgccatacgcaaaaaggaa
gcgactcatagaatggcagaggcaaatagagctcttgcacattttcgttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131444
Entry
3131444           CDS       T01015                                 
Symbol
rps7, OrsajCp103
Name
(RefSeq) ribosomal protein S7
  KO
K02992  small subunit ribosomal protein S7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    3131444 (rps7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    3131444 (rps7)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    3131444 (rps7)
  Bacteria
    3131444 (rps7)
  Archaea
    3131444 (rps7)
SSDB
Motif
Pfam: Ribosomal_S7
Other DBs
NCBI-GeneID: 3131444
NCBI-ProteinID: NP_039458
UniProt: P0C491 A0A0K0LR14 Q6YTM6
LinkDB
Position
Pltd:126704..127174
AA seq 156 aa
MSRRGTAEKRTAKSDPIFRNRLVNMVVNRIMKDGKKSLAYQILYRAVKKIQQKTETNPLL
VLRQAIRRVTPNIGVKTRRNKKGSTRKVPIEIGSKQGRALAIRWLLEASQKRPGRNMAFK
LSSELVDAAKGGGGAIRKKEATHRMAEANRALAHFR
NT seq 471 nt   +upstreamnt  +downstreamnt
atgtcacgtcgaggtactgcagaaaaaagaactgcaaaatccgatccaatttttcgtaat
cgattagttaacatggtggttaaccgtattatgaaagacggaaaaaaatcattggcttat
caaattctctatcgagccgtgaaaaagattcaacaaaagacagaaacaaatccactattg
gttttacgtcaagcaatacgtagagtaactcccaatataggagtaaaaacaagacgtaat
aaaaaaggatcgacgcggaaagttccgattgaaataggatctaaacaaggaagagcactt
gccattcgttggttattagaagcatcccaaaagcgtccgggtcgaaatatggctttcaaa
ttaagttccgaattagtagatgctgccaaagggggtgggggtgccatacgcaaaaaggaa
gcgactcatagaatggcagaggcaaatagagctcttgcacattttcgttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131445
Entry
3131445           CDS       T01015                                 
Symbol
rps7, OrsajCp076
Name
(RefSeq) ribosomal protein S7
  KO
K02992  small subunit ribosomal protein S7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    3131445 (rps7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    3131445 (rps7)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    3131445 (rps7)
  Bacteria
    3131445 (rps7)
  Archaea
    3131445 (rps7)
SSDB
Motif
Pfam: Ribosomal_S7
Other DBs
NCBI-GeneID: 3131445
NCBI-ProteinID: NP_039433
UniProt: P0C491 A0A0K0LR14 Q6YTM6
LinkDB
Position
Pltd:complement(87944..88414)
AA seq 156 aa
MSRRGTAEKRTAKSDPIFRNRLVNMVVNRIMKDGKKSLAYQILYRAVKKIQQKTETNPLL
VLRQAIRRVTPNIGVKTRRNKKGSTRKVPIEIGSKQGRALAIRWLLEASQKRPGRNMAFK
LSSELVDAAKGGGGAIRKKEATHRMAEANRALAHFR
NT seq 471 nt   +upstreamnt  +downstreamnt
atgtcacgtcgaggtactgcagaaaaaagaactgcaaaatccgatccaatttttcgtaat
cgattagttaacatggtggttaaccgtattatgaaagacggaaaaaaatcattggcttat
caaattctctatcgagccgtgaaaaagattcaacaaaagacagaaacaaatccactattg
gttttacgtcaagcaatacgtagagtaactcccaatataggagtaaaaacaagacgtaat
aaaaaaggatcgacgcggaaagttccgattgaaataggatctaaacaaggaagagcactt
gccattcgttggttattagaagcatcccaaaagcgtccgggtcgaaatatggctttcaaa
ttaagttccgaattagtagatgctgccaaagggggtgggggtgccatacgcaaaaaggaa
gcgactcatagaatggcagaggcaaatagagctcttgcacattttcgttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 6450151
Entry
6450151           CDS       T01015                                 
Symbol
rps7, OrsajM_p06
Name
(RefSeq) ribosomal protein S7
  KO
K02992  small subunit ribosomal protein S7
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    6450151 (rps7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    6450151 (rps7)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    6450151 (rps7)
  Bacteria
    6450151 (rps7)
  Archaea
    6450151 (rps7)
SSDB
Motif
Pfam: Ribosomal_S7 SPACA9
Other DBs
NCBI-GeneID: 6450151
NCBI-ProteinID: YP_002000553
UniProt: Q8HCR2
LinkDB
Position
MT:complement(46565..47011)
AA seq 148 aa
MGDFDGEQKELIKKLVNFRMIDGKRTRVRAIVYKTFHRLARTERDVIKLMVDAVDNIKPI
CEVVKVGVAGTIYDVPGIVARDRQQTLAIRWIFGAAFKRRISYRISLEKCLFAEILDAYR
KRGISRKRRGNLHGLASTNRSFAHFRWW
NT seq 447 nt   +upstreamnt  +downstreamnt
atgggggactttgatggtgagcaaaaagaattgatcaagaaattggtaaactttcgcatg
atcgatggtaaaagaacgagagttcgtgctattgtttataaaacttttcaccgcctagct
cgaactgaacgcgatgtaatcaaacttatggttgacgccgtagataatataaagccaata
tgcgaagtggtcaaagtaggagtcgcaggtactatttatgatgttcctgggattgtagcc
agggatcgtcaacaaaccttagctattcgttggatccttggagcagctttcaaacgacgt
ataagctacaggataagcttagagaaatgttcatttgctgagatactggatgcttaccga
aagaggggaatttcacgtaagagaagggggaatcttcatggactggcttccaccaatcgg
agtttcgcgcatttcagatggtggtaa

DBGET integrated database retrieval system