KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107281488
Entry
107281488         CDS       T01015                                 
Name
(RefSeq) acidic endochitinase-like
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    107281488
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     107281488
SSDB
Motif
Pfam: Glyco_hydro_18
Other DBs
NCBI-GeneID: 107281488
NCBI-ProteinID: XP_015644933
UniProt: A3BIR3
LinkDB
Position
7:complement(11273877..11275576)
AA seq 297 aa
MANKSSLLQLLLIAAVASQFVSSQAGSIAIYWGQNNGEGTLADTCATGNYKFVNIAFLAA
FGNGQPPVFNLAGHCDPTNGGCASQSSDIKSCQSRGVKIMLSIGGGAGSYYLSSSEDAKN
VATYLWNNFLGGQSSSRPLGDAVLDGIDFDIEGGTNQHWDDLARYLKGYSNSGRRVYLTA
APQCPFPDACIGDALNTGLFDYVWVQFYNNPPCQYSSGSTSNLADAWKQWLSVPAKQIFL
GLPASPQAAGSGFIPADDLKSQVLPVIKSSGKYGGIMLWSKYYDDQDDYSSSVKSDV
NT seq 894 nt   +upstreamnt  +downstreamnt
atggctaacaaatcatccctgctacagctgctgctcatcgcagcagttgcttcgcaattc
gtcagttcacaagccggtagcattgctatctactggggccagaacaacggggagggcaca
ctggcagacacctgcgccactggcaactacaagttcgtcaacatcgccttcctcgcggcc
ttcggcaatggccagccaccagtcttcaacctggcaggccactgtgacccaaccaatggc
ggttgcgccagccagagctccgacatcaagtcgtgccagagccgcggagtcaagatcatg
ctctccataggcggaggggcaggaagctactacctttcatcatcagaggatgccaagaat
gtcgcaacatacctgtggaacaacttcctgggaggccagtcatcttctcgccctctaggt
gacgcggtccttgacggcattgacttcgacattgagggcggcaccaaccagcactgggat
gatcttgccaggtacctgaaagggtacagtaactctggaaggagggtatacctgacggct
gcgccgcagtgcccattccctgatgcctgcatcggtgatgctctaaacactggcctcttc
gactatgtctgggtgcagttctacaacaaccctccctgccagtacagttcaggcagcacc
tctaatcttgctgatgcatggaagcagtggctttcagtcccagcaaagcagatttttctt
ggccttcctgcatctccccaggcggctgggagcggtttcatcccagcagatgatctcaag
tcacaggtgcttccagtgatcaagagctcagggaaatacggaggcatcatgctgtggtcc
aagtactacgatgaccaagatgactatagctcttcagtgaagagcgatgtttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107281711
Entry
107281711         CDS       T01015                                 
Name
(RefSeq) hevamine-A-like
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    107281711
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     107281711
SSDB
Motif
Pfam: Glyco_hydro_18
Other DBs
NCBI-GeneID: 107281711
NCBI-ProteinID: XP_015646370
LinkDB
Position
7:13469701..13474783
AA seq 301 aa
MASSRLALPAAIFCAVVVAASLGGAAATGKTGRITVYWGQTSSEGGLREACGTGLYSTVI
ISFLTDFGGGNYKLNLAGHAWSAVGPDVKYCRSKGVLVLLSIGGGVGRYSLASQADAKAV
ADHLWNFYLGGTSTMSWPFGDAVLDGVDFDIELGSNAHYGDLARYLKAYSGRKPGGRKVW
LTAAPQCPFPDRMLGEALRTGLFDRVHVQFYNNPVCNYRASNVAAFTSAWNKWAASLPGS
SVYLGLPAVSGAANNGYVAPATLKENVLPIVQKSKNYGGIMLWSRNWDKQTGYSKSVKSA
V
NT seq 906 nt   +upstreamnt  +downstreamnt
atggcgtcatcccggctggccttgccggccgccatcttctgcgccgtcgtcgtcgccgcg
tcgctgggtggagcggcggcgacgggcaagaccggccggatcacggtgtactgggggcag
acgagcagcgagggcgggctccgggaggcatgcggcacaggcctctactccaccgtgatc
atctccttcctgaccgacttcggcggcggcaactacaagctcaacctcgccggccacgcc
tggagcgccgtcggaccggacgtcaagtactgccggtccaagggcgtcctcgtcctcctc
tctatcggcggcggcgtcggcaggtactccctggcctcgcaggccgatgccaaggccgtc
gccgaccacctctggaacttctacctcggtgggaccagcaccatgtcctggccgttcggc
gacgccgtgctcgacggcgtcgacttcgacatcgagctgggcagcaacgcccactacggc
gacctcgccaggtacctcaaggcgtacagcgggaggaagcccggagggaggaaggtgtgg
ctgacggcggcgccgcagtgcccgttcccggacaggatgctcggcgaggcgctgcgcacg
gggctgttcgaccgagtgcacgtccagttctacaacaacccggtctgcaactaccgcgcc
agcaacgtggccgcgttcacctccgcatggaacaagtgggcggcgagcctccccgggagc
tccgtctacctcggcctcccggcggtgagcggcgcagcgaacaacgggtacgtggctccg
gcgacgctgaaagagaacgtgctgccgatcgtgcagaagtccaagaactacggcggtatc
atgctgtggagcaggaactgggacaagcagaccggctacagcaagagtgtcaagtctgcc
gtgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4323899
Entry
4323899           CDS       T01015                                 
Name
(RefSeq) acidic endochitinase SE2
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4323899
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     4323899
SSDB
Motif
Pfam: Glyco_hydro_18
Other DBs
NCBI-GeneID: 4323899
NCBI-ProteinID: XP_015644857
UniProt: Q657I8 A0A0P0V1L6
LinkDB
Position
1:11208195..11209819
AA seq 335 aa
MHCYISLSSICRSTKQYTMATRANGSSCSLASLMAAIFFLLVVSSRGAHGGRIAIYWGQN
GNEGTLADTCATGNYAFVNLAFLCSFGSGQAPQLNLAGHCDAYSGACANLTADIARCQSM
GVKVLLSIGGGAGGYSLASKQDVSHLARYLWESFLGGRPSAPGGRRPLGDAVLDGVDFDI
EGGGGDPRYYGDLAAYLKAYSGKGAAGKEVLLSAAPQCPFPDQWVGKALDTGLFDYVWVQ
FYNNPPCQYAAGSGGGAANLLDAWRQWTSGVEARYIFLGLPASPGAAGSGFIPVGSLESQ
VLPALKASSKYGGVMLWSRYYDDQDGYSSAIKNAV
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgcattgctatatctctctctcgtcgatctgcagatcgaccaagcaatacacaatggcc
actcgggcaaacggcagctcatgctccctggccagcctcatggcggccatcttcttcctc
ctagtcgtctcctcccggggcgcccatggcggcagaattgccatctactggggccagaac
ggcaacgagggcaccctcgccgacacctgcgccacgggcaactacgccttcgtcaacctc
gccttcctctgcagcttcggctcgggccaggccccgcagctcaacctcgccggccactgc
gacgcctactcgggcgcctgcgccaacctcaccgccgacatcgcccgctgccagtccatg
ggcgtcaaggtcctcctctccatcggcggcggcgccggcggctactcgctcgcctccaag
caggacgtgtcccacctcgcccggtacctctgggagagcttcctcggcggccgcccgtcg
gcgccgggcggcaggaggccgctcggcgacgcggtgctcgacggcgtcgacttcgacatc
gagggcggcggcggcgacccccgctactacggcgacctcgccgcgtacctcaaggcgtac
agcggcaagggcgccgccggcaaggaggtgctcctctcggcggcgccgcagtgcccgttc
ccggaccagtgggtcggcaaggcgctcgacaccggcctgttcgactacgtgtgggtgcag
ttctacaacaacccgccgtgccagtacgccgcagggagcggcggcggcgccgccaacctg
ctcgacgcatggcgccagtggacgtcgggggtggaggccaggtacatcttcctcgggctg
ccggcgtcgcccggcgcggcggggagcgggttcatcccggtggggagcctcgagtcgcag
gtgttgccggcgctgaaggcgtcgagcaagtacggcggggtgatgctgtggtccaggtac
tacgacgatcaggatggatacagctccgccatcaagaatgccgtctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324117
Entry
4324117           CDS       T01015                                 
Name
(RefSeq) acidic endochitinase
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4324117
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     4324117
SSDB
Motif
Pfam: Glyco_hydro_18
Other DBs
NCBI-GeneID: 4324117
NCBI-ProteinID: XP_015627500
UniProt: Q8RU26 A0A0P0V6T4
LinkDB
Position
1:complement(28354824..28356134)
AA seq 302 aa
MAPRLCCSSQFLLAVSFLAAFAAVSNAGKVAVYWGQGAGNGDGTLAETCATGLYDFVNIA
FLNVYGSGLTPVLNLAAHCNPDAGTCKSLSSEISSCQQSGVKVLLSLGGERGQYSLSSAD
DARGVADYLWNTFLGGSSDSRPLGDAVLDGIDFDIEKDGDHYDELAMALSSKCNGACVLT
AAPQCPYPDAHLDAAIKTGVFSHVWVQFYNNRQCQYASGDASALQAAWAQWTSGVPAPAD
VFLGLPTAPAAAPSGGYIDADTLLSQVLPAVEGAAANYGGVMLWNRWRDVTAGYGAKLKG
KV
NT seq 909 nt   +upstreamnt  +downstreamnt
atggctcccaggctctgctgctcttctcaattcttgctcgccgtctccttcctggccgcc
ttcgcggccgtctccaacgccggcaaggtggccgtctactgggggcagggggcgggcaac
ggcgacggcaccctcgccgagacatgcgccaccggcctgtacgacttcgtcaacatcgcc
ttcctcaacgtctacggcagcggccttaccccggtgctcaacctcgccgcccactgcaat
ccggacgcggggacctgcaagtcgctcagctccgagatcagctcctgccagcagagcggc
gtgaaggtgctcctctccctcggcggcgagagaggtcagtactccctctcctccgccgac
gacgcgcgtggcgtcgccgactacctctggaacaccttcctcggcggcagctcggactcg
cgccccctcggcgacgcggtgctcgacggcatcgacttcgacatagagaaggacggtgac
cactacgacgagctggcgatggccctctcgtcgaaatgcaacggcgcgtgcgtgctcacg
gcggcgccgcagtgcccgtacccggacgcccacctcgacgcggcgatcaagaccggggtg
ttcagccacgtttgggtgcagttctacaacaaccggcagtgccagtacgccagcggcgac
gcgagcgcgctgcaggccgcgtgggcgcagtggacgagcggcgtgccggcgcccgcggac
gtcttcctgggcctgccgacggcgccggccgctgcaccgagcggaggctacatcgacgcg
gacacgctgctgtcgcaggtgctaccggcggtggagggcgcggcggcgaactacggcgga
gtcatgctgtggaatcgctggagagacgtgaccgctggttatggcgccaagttgaagggg
aaagtttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325066
Entry
4325066           CDS       T01015                                 
Name
(RefSeq) acidic endochitinase
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4325066
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     4325066
SSDB
Motif
Pfam: Glyco_hydro_18
Other DBs
NCBI-GeneID: 4325066
NCBI-ProteinID: XP_015618646
UniProt: Q8RZ29 Q0JHJ3
LinkDB
Position
1:37235759..37237209
AA seq 297 aa
MASRALTPMQLIGTVFVALLATCHAGGIAVYWGQNDGEASLAETCASGNYEFVIIAFLPK
FGKGQTPRVDLASHCDPASGGCTGQSKDIRACQRRGVKVLLSIGGGDGSYGLSSPGDARQ
VAMYLWNNFLGGSSSSRPLGDAVLDGIDFDIELGGAKFWDDLARDLKSLGRSGGRRVVLS
AAPQCPFPDEWDGGAISTGLFDAVWVQFYNNPECQFSAGRGAFMDAWRKWESVPAGRLFL
GLPASKDAAGTGFVPAGELNSRVLPLIRGSPKYGGVMLWSKYYDDQTGYSSAIKSHV
NT seq 894 nt   +upstreamnt  +downstreamnt
atggcgagccgagctctcactcccatgcagctcattggcacggtcttcgtggcgctcctc
gcgacgtgccacgccggcggcatcgccgtgtactggggccagaacgacggcgaggcatcg
ctggccgagacgtgcgcgtcgggcaactacgagttcgtcatcatcgccttcctccccaag
ttcggcaagggccagacgccgcgggtggacctcgccagccactgcgatcccgcgtcgggc
ggctgcaccggccagagcaaggacatccgcgcgtgccagcgccgcggggtgaaggtcctg
ctctccatcggcggcggcgacggcagctacggcctctcatcccccggtgacgcccggcag
gtggccatgtacctctggaacaacttcctcggcggctcctcctcgtcccgtcccctcggc
gacgccgtcctcgacggcatcgacttcgacatcgagctcggcggcgccaagttctgggac
gacctcgccagggatctgaagagcctggggaggagcggcgggaggagggtggtgctgagc
gcggcgccgcagtgcccgttcccggacgagtgggacggcggcgcgatcagcacggggctg
ttcgacgccgtgtgggtgcagttctacaacaacccggagtgccagttcagcgcggggcgg
ggcgcgttcatggacgcgtggaggaagtgggagtcggtgccggcggggcgactcttcctg
ggcctcccggcgtccaaggacgccgccggcaccgggttcgtgcccgccggcgagctcaac
tcccgcgtgctgccgctcatcaggggctcccccaagtacggcggcgtcatgctgtggtcc
aagtactacgacgatcaaaccggctacagctccgccatcaagagccacgtgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325067
Entry
4325067           CDS       T01015                                 
Name
(RefSeq) hevamine-A
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4325067
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     4325067
SSDB
Motif
Pfam: Glyco_hydro_18
Other DBs
NCBI-GeneID: 4325067
NCBI-ProteinID: XP_015618637
UniProt: Q0JHJ2 O49827
LinkDB
Position
1:37238921..37240718
AA seq 305 aa
MMTSRMFSAMQMLIMVVVALAGLAAGARAGDIAIYWGQNGNEGTLAQTCATGNYRFVIVA
FLPVFGKGQTPVLNLAGHCDPASNGCTGVGADIKSCQSLGIKVMFSIGGGVGNYGLSSRD
DAKQVAAYLWNNYLGGTSPSRPLGDAVMDGIDFDIESGGGMYWDDLARYLKAYSRQGSSK
KPVYLTAAPQCPFPDASLGVALSTGLFDYVWVQFYNNPPCQYSSSNGVGNLASAWKQWTS
IPAGRVFLGLPAAAEAAGSGFVETSDLVSKVLPVVKKSPKYGGIMLWSRYYDGLTGYSDK
VKSSV
NT seq 918 nt   +upstreamnt  +downstreamnt
atgatgacaagtagaatgttttcggcaatgcagatgctgatcatggtggtggtggcattg
gccgggctagctgccggagcgcgcgccggcgacatcgcgatctactggggccagaacggc
aacgagggcacgctggcgcagacgtgcgcgaccggtaattacaggttcgtcatcgtggcc
ttcctgcctgtgttcggcaagggccagacgccggtgctgaacctggccggccactgcgac
ccggcgtcgaacggctgcaccggcgtgggcgccgacatcaagtcgtgccagagcctcggc
atcaaggtcatgttctcgatcggcggcggcgtcggcaactacggcctgtcctcccgcgac
gacgccaagcaggtcgcggcgtacctgtggaacaactacctcggcggcacgtcgccgtca
aggccgctcggcgacgccgtcatggacggcatcgacttcgacatcgagagcggcgggggc
atgtactgggacgacttggccaggtacctcaaggcgtactcgcggcaggggagcagcaag
aagccggtgtacctgacggcggcgccacagtgccccttcccggacgcgtcgctcggcgtc
gcgctcagcaccggcctgttcgactacgtgtgggtgcagttctacaacaacccgccgtgc
cagtacagctcgtccaacggcgtgggcaacctggcgagcgcgtggaagcagtggacgtcg
atcccggcgggacgggtgttcctcggcctgccggcggcggcggaggccgccggcagcggg
ttcgtggagacgagcgacctggtgtcgaaggtgctccccgtggtgaagaagtctcccaag
tacggagggatcatgctgtggtcgcggtactatgacgggctcacggggtacagcgacaag
gtgaagtccagcgtttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4327172
Entry
4327172           CDS       T01015                                 
Name
(RefSeq) acidic endochitinase
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4327172
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     4327172
SSDB
Motif
Pfam: Glyco_hydro_18 Phage_G
Other DBs
NCBI-GeneID: 4327172
NCBI-ProteinID: XP_015622676
UniProt: O22080 Q7F4M8
LinkDB
Position
1:26885468..26886720
AA seq 301 aa
MAANKLKFSPLLALFLLAGIAVTSRAGDIAVYWGQNGDEGSLADACNSGLYAYVMVAFLS
TFGNGQTPVLNLAGHCEPSSGGCTGQSSDIQTCQSLGVKVILSIGGGAGSYGLSSTQDAQ
DVADYLWNNFLGGSSGSRPLGDAVLDGVDFDIETGNPAHYDELATFLSRYSAQGGGKKVI
LTAAPQCPYPDASLGPALQTGLFDSVWVQFYNNPPCQYANGDASNLVSAWNTWTGGVSAG
SFYVGVPAAEAAAGSGYVAPGDLTSAVLPAVQGNAKYGGIMVWNRFYDVQNNFSNQVKSS
V
NT seq 906 nt   +upstreamnt  +downstreamnt
atggctgctaataagctcaagttctcccctctccttgccctcttcctcctcgccggcata
gccgtcacctcccgtgccggcgacatcgccgtgtactggggccagaacggcgacgagggc
agcctggccgacgcctgcaactccggcctatacgcgtacgtcatggtcgccttcctcagc
accttcggcaacggccagacccctgtcctcaacctcgccgggcactgcgaaccaagctcc
ggcggctgcaccggccagagctcggacatccagacgtgccagtcgctgggcgtcaaggtc
atcctgtccatcggcggcggcgccggcagctacgggctgtcgtccacccaggacgcccag
gacgtggccgactacctgtggaacaacttcctcggcggcagctcgggctcccggccgctc
ggcgacgccgtgctggacggcgtcgacttcgacatcgagaccggcaacccggcgcactac
gacgagctcgccacgttcctgtcgcggtacagcgcgcaggggggcggcaagaaggtgatc
ctgacggcggcgccgcagtgcccctacccggacgcgtcgctggggccggcgctgcagacg
gggctgttcgacagcgtgtgggtgcaattctacaacaacccgccgtgccagtacgccaac
ggcgacgccagcaacctggtgagcgcgtggaacacgtggaccggcggcgtcagcgccggg
agcttctacgtcggcgtgccggcggcggaggccgcggcggggagcgggtacgtggcaccc
ggcgacctgacgtcggcggtgctccccgccgtgcagggcaacgccaagtacggcggcatc
atggtgtggaaccggttctacgacgtgcagaacaacttcagcaaccaggtgaagagcagc
gtctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329920
Entry
4329920           CDS       T01015                                 
Name
(RefSeq) chitinase 6
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4329920
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     4329920
SSDB
Motif
Pfam: Glyco_hydro_19 Chitin_bind_1
Other DBs
NCBI-GeneID: 4329920
NCBI-ProteinID: XP_015623420
UniProt: Q6K8R2
LinkDB
Position
2:complement(23742972..23744110)
AA seq 271 aa
MARRLSLLAVVLAMVAAVSASTAAAQSCGCASDQCCSKWGFCGTGSDYCGTGCQAGPCDV
PATNDVSVASIVTPEFFAALVAQADDGCAAKGFYTRDAFLTAAGGYPSFGRTGSVDDSKR
EIAAFFAHANHETIKFCYIEEIDGPSKNYCDETSTQWPCMAGKGYYGRGPLQISWNFNYG
PAGQSIGFDGLGDPDAVARSPVLAFQTALWYWTNNVHDAFVSGQGFGATIRAINGALECD
GKNPTAVSNRVAYYQQFCQQFGVDPGSNLTC
NT seq 816 nt   +upstreamnt  +downstreamnt
atggcgcgaaggctctcgctgctggccgtcgtgctggcgatggtggcggccgtgtcggcg
agcacggcggcggcgcagagctgcgggtgcgcgtcggaccagtgctgcagcaagtggggg
ttctgcggcaccggcagcgactactgcggcacggggtgccaggcgggcccctgcgacgtg
ccggccaccaacgacgtgtccgtggcgagcatcgtcacgccggagttcttcgcggcgctc
gtcgcccaggccgacgacggctgcgccgccaagggcttctacacccgcgacgccttcctc
accgccgccggtggctacccttccttcggccgcaccggctccgtcgacgactccaagcgc
gagatcgccgccttcttcgcccacgccaaccacgagaccataaagttctgctacatcgag
gagatcgacggaccgagcaagaactactgcgacgagacgagcacgcagtggccgtgcatg
gcggggaaggggtactacgggcgcgggccgctgcagatctcgtggaacttcaactacggg
ccggcggggcagagcatcgggttcgacgggctgggcgacccggacgcggtggcgaggagc
cccgtgctggcgttccagacggcgctctggtactggaccaacaacgtgcacgacgccttc
gtctccggccaggggttcggcgccaccatccgcgccatcaacggcgcgctcgagtgcgac
ggcaagaaccccaccgccgtcagcaaccgcgtcgcctactaccagcagttctgccagcag
ttcggcgtcgaccccggcagcaacctcacctgctaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331519
Entry
4331519           CDS       T01015                                 
Name
(RefSeq) chitinase 11
  KO
K20547  basic endochitinase B [EC:3.2.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4331519
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4331519
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     4331519
SSDB
Motif
Pfam: Glyco_hydro_19
Other DBs
NCBI-GeneID: 4331519
NCBI-ProteinID: XP_015630175
UniProt: Q10S66
LinkDB
Position
3:1860415..1861783
AA seq 256 aa
MRRLLPLAGATLLIAAAGGASGQQAGVGSIITRAMFESMLSHRGDQGCQGAFYTYDAFIK
AAGDFPRFGTTGNDETRRRELAAFFGQTSHETTGGWATAPDGPFAWGYCRVNEITPSDPP
YYGRGPIQLTHKYNYQLAGDALGLDLVNNPDLVSSDPVVAFRTAIWFWMTAQSPKPSCHD
VITNQWTPSGDDRSSGRLPGYGMATNIINGGEECGKGYSTDNAKDRVGYYKRYCDMFRVG
YGDNIACRDQKPYGGG
NT seq 771 nt   +upstreamnt  +downstreamnt
atgagaaggcttctcccgctcgccggcgccacgctgctgatcgcggcggccggcggcgcc
agcgggcagcaggcgggtgttgggtcgatcatcacgcgggcgatgttcgagtcgatgctg
agccaccgtggggaccaaggttgccagggcgccttctacacctacgacgcgttcatcaag
gccgccggagatttccctagattcggcacgaccggcaacgacgaaacgcgccggcgcgag
ctcgccgctttctttggccagacctcccacgaaactacaggtggatgggcaactgctcct
gatggaccctttgcttggggatactgccgggtgaacgagatcacgccgtcggacccgccc
tactacggccgaggacccatacagcttactcataagtacaactaccagctagccggggac
gcgttgggtctggacctggtgaacaaccccgacctggtgtcaagcgaccccgtggtggcg
ttcaggacggccatctggttctggatgacggcgcagtcacccaagccgtcgtgccacgac
gtaatcaccaaccagtggacgccgtccggcgatgaccgtagctccgggaggctccccggc
tacggcatggccaccaacatcatcaacggcggtgaagagtgcggcaagggctactccacc
gacaacgccaaggaccgggtcggctactacaagaggtactgcgacatgttccgcgtagga
tacggagataacatagcctgcagggaccagaagccctacggaggaggttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4333121
Entry
4333121           CDS       T01015                                 
Name
(RefSeq) chitinase 12
  KO
K20547  basic endochitinase B [EC:3.2.1.14]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00520  Amino sugar and nucleotide sugar metabolism
osa01100  Metabolic pathways
osa04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    4333121
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4333121
Enzymes [BR:osa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     4333121
SSDB
Motif
Pfam: Glyco_hydro_19 Chitin_bind_1
Other DBs
NCBI-GeneID: 4333121
NCBI-ProteinID: XP_015629397
UniProt: P25765
LinkDB
Position
3:17390796..17392051
AA seq 326 aa
MRALAVVAMVATAFLAAAVHAEQCGSQAGGAVCPNCLCCSQFGWCGSTSDYCGAGCQSQC
SAAGCGGGGPTPPSGSGGSGVASIVSRSLFDQMLLHRNDAACPASNFYTYDAFVAAASAF
PGFAAAGGDADTNKREVAAFLAQTSHETTGGWATAPDGPYAWGYCFKEENGGAAGPDYCQ
QSAQWPCAAGKKYYGRGPIQLSYNFNYGPAGQAIGADLLGDPDLVASDATVSFDTAFWFW
MTPQSPKPSCHAVATGQWTPSADDQAAGRVPGYGVITNIINGGLECGHGEDDRVADRIGF
YKRYCDILGVSYDANLDCYSQRPFGS
NT seq 981 nt   +upstreamnt  +downstreamnt
atgagagcgctcgctgtggtggccatggtggccacggccttcctcgcggcggccgtgcat
gccgagcagtgcggcagccaggccggcggcgcggtgtgccccaactgcctctgctgcagc
cagttcggctggtgcggctccacctccgactactgcggcgccggatgccagagccagtgc
tccgccgccggctgcggcggcggcggcccgaccccgccgtccggcagcggtggcagcggc
gtcgcgtccatcgtgtcgcgctcgctcttcgaccagatgctgctccaccgcaacgatgcg
gcgtgcccggccagcaacttctacacctacgacgccttcgtcgccgccgccagcgccttc
ccgggcttcgccgccgcgggcggcgacgccgacaccaacaagcgcgaggtcgccgcgttc
cttgcgcagacgtcccacgagaccaccggcgggtgggcgacggcgcccgacggcccctac
gcgtggggctactgcttcaaggaggagaacggcggcgccgccgggccggactactgccag
cagagcgcgcagtggccgtgcgccgccggcaagaagtactacggccggggtcccatccag
ctctcctacaacttcaactacgggccggcggggcaggccatcggcgccgacctgctcggc
gacccggacctcgtggcgtccgacgccaccgtctccttcgacacggccttctggttctgg
atgacgccgcagtcgcccaagccgtcgtgccacgcggtcgccaccggccagtggacgccc
tccgccgacgaccaggcggcgggccgcgtgccgggctacggcgtcatcaccaacatcatc
aacggcgggctggagtgcggccatggcgaggacgatcgcgtcgccgaccggatcggcttc
tacaagcgctactgcgacatcctcggcgtcagctacgacgccaacttggattgctacagc
cagaggcccttcggctcctaa

DBGET integrated database retrieval system