KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131422
Entry
3131422           CDS       T01015                                 
Symbol
rpl14, OrsajCp064
Name
(RefSeq) ribosomal protein L14
  KO
K02874  large subunit ribosomal protein L14
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    3131422 (rpl14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    3131422 (rpl14)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    3131422 (rpl14)
  Bacteria
    3131422 (rpl14)
  Archaea
    3131422 (rpl14)
SSDB
Motif
Pfam: Ribosomal_L14
Other DBs
NCBI-GeneID: 3131422
NCBI-ProteinID: NP_039422
UniProt: P0C440 Q7F4T2 Q6Z509
LinkDB
Position
Pltd:complement(77248..77619)
AA seq 123 aa
MIQPQTLLNVADNSGARKLMCIRVIGAASNQRYARIGDVIVAVIKDAVPQMPLERSEVIR
AVIVRTCKEFKCEDGIIIRYDDNAAVIIDQKGNPKGTRVFGAIAEELRELNFTKIVSLAP
EVL
NT seq 372 nt   +upstreamnt  +downstreamnt
atgattcaacctcagacccttttaaatgtagcagataacagtggagctcgaaaattgatg
tgtattcgagtcataggagctgctagtaatcagcgatatgctcgtattggtgatgttatt
gttgctgtaatcaaagacgcagtgccccaaatgcctctagaaagatccgaagtaattcga
gctgtaattgtacgtacatgtaaagagttcaaatgcgaagacggtataataatacgctat
gacgacaatgcagcggttatcattgatcaaaaaggaaatccaaaaggaactcgcgttttt
ggcgcgatcgccgaggaattgagagaattgaattttactaaaatagtttcattagctcct
gaagtattataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4352797
Entry
4352797           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein HLP, mitochondrial
  KO
K02874  large subunit ribosomal protein L14
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4352797
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4352797
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4352797
  Bacteria
    4352797
  Archaea
    4352797
SSDB
Motif
Pfam: Ribosomal_L14
Other DBs
NCBI-GeneID: 4352797
NCBI-ProteinID: XP_015620603
UniProt: Q2QM60 Q0ILW6
LinkDB
Position
12:complement(26139487..26141775)
AA seq 170 aa
MAAFLRSKCSSVGRTLMGGLGNNLFGAVNSSVETVSRPSHCDPIFQQIRTFIQMRTNLKV
VDNSGAKRVMCIQSLRGKKGARLGDTIIGSVKEAQPRGKVKKGDVVYGVVVRAAMKRGRN
DGSEIQFDDNAIVLVNNKGELIGTRVFGPVPHELRKKKHLKILALAEHIV
NT seq 513 nt   +upstreamnt  +downstreamnt
atggcagcattcctgaggtcaaaatgttcgtcagttggacgtaccttgatgggaggcctt
gggaacaatctatttggagccgttaactcatctgttgaaacggtgtcaagaccatctcat
tgtgatcctatctttcagcaaatcagaacattcatccagatgagaacaaacctaaaggtg
gtagacaactctggtgccaagcgcgttatgtgcatccagtccttgagggggaagaaagga
gcgaggctcggggacactataattggatctgtcaaggaagcacagcctcgtggtaaggtg
aagaaaggagatgtggtctatggagtggttgtccgtgctgctatgaagcgaggacgcaac
gatggcagcgagatccagtttgatgacaacgcgattgtccttgtgaacaacaaaggcgag
ctgattggcactcgtgtatttggtcctgttccccacgaactcaggaaaaagaagcatctc
aagatcctagcgttagcggaacacatagtttga

DBGET integrated database retrieval system