KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131423
Entry
3131423           CDS       T01015                                 
Symbol
rpl16, OrsajCp065
Name
(RefSeq) ribosomal protein L16
  KO
K02878  large subunit ribosomal protein L16
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    3131423 (rpl16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    3131423 (rpl16)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    3131423 (rpl16)
  Bacteria
    3131423 (rpl16)
SSDB
Motif
Pfam: Ribosomal_L16 GspL_C
Other DBs
NCBI-GeneID: 3131423
NCBI-ProteinID: NP_039423
UniProt: P0C443
LinkDB
Position
Pltd:complement(77729..79198)
AA seq 136 aa
MLSPKRTRFRKQHRGRMKGKSYRGNCICFGRYALQALEPTWITARQIEAGRRAMTRYARR
GGKIWVRIFPDKPVTIRPTETRMGSGKGSPEYWVAVVKPGRILYEMGGVSETVARRAISI
AASKMPIRSQFLRLEI
NT seq 411 nt   +upstreamnt  +downstreamnt
atgcttagtcccaaaagaaccagatttcgtaaacaacatagaggaagaatgaagggaaaa
tcctaccgaggcaattgtatttgttttggtagatatgctcttcaagcacttgaacccact
tggattacggcgaggcagatagaagcaggacgaagagcaatgacacgatatgcacgtcgt
ggtggaaaaatctgggtacgtatatttcccgacaaaccggttacaataagaccgaccgaa
acacgtatgggttcgggaaagggatcccccgaatattgggtagccgttgttaaaccaggt
cgaatactttatgaaatgggcggagtatccgaaactgtagctagacgagctatttccata
gctgccagcaaaatgcccatacgaagtcaatttcttcggttagaaatataa

DBGET integrated database retrieval system