KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131426
Entry
3131426           CDS       T01015                                 
Symbol
rpl22, OrsajCp067
Name
(RefSeq) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    3131426 (rpl22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    3131426 (rpl22)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    3131426 (rpl22)
  Bacteria
    3131426 (rpl22)
  Archaea
    3131426 (rpl22)
SSDB
Motif
Pfam: Ribosomal_L22 Mt_ATP-synt_D
Other DBs
NCBI-GeneID: 3131426
NCBI-ProteinID: NP_039425
UniProt: P0C444 P0C446 B9G372 A0A8J8XAU1
LinkDB
Position
Pltd:complement(80119..80568)
AA seq 149 aa
MTSFKLVKYTPRIKKKKSGLRKLARKVPTDRLLKFERVFKAQKRIHMSVFKVQRVLDEIR
WRYYEETVMILNLMPYRASYPILKLVYSAAANATHYRDFDKANLFITKAEVSRSTIMNKF
RPRARGRSSPIKKTMCHITIVLNIVKKSK
NT seq 450 nt   +upstreamnt  +downstreamnt
atgacaagtttcaaactggtaaagtatacccctaggataaagaagaagaagagtgggcta
aggaaactcgcaagaaaagtaccaaccgatcgtctacttaagttcgaacgggttttcaaa
gcacaaaaacgcatccacatgtccgttttcaaagtacaaagagttctggatgagattcgt
tggcgttactacgaagaaactgttatgatattgaacctcatgccttatcgagcatcttat
cccatcttaaagttggtttattcggcagcagcaaatgctactcattatagggatttcgac
aaagcaaatttattcatcactaaagccgaagtcagtaggagtactattatgaataaattc
agacctcgggctcgaggacgtagttctcccataaaaaaaaccatgtgtcatataacaatt
gtactaaatatagtaaagaaatcgaaataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326653
Entry
4326653           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4326653
  KO
K02890  large subunit ribosomal protein L22
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4326653
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4326653
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4326653
  Bacteria
    4326653
  Archaea
    4326653
SSDB
Motif
Pfam: Ribosomal_L22
Other DBs
NCBI-GeneID: 4326653
NCBI-ProteinID: XP_015624430
UniProt: Q0JL86 Q5ZDK4
LinkDB
Position
1:24480850..24483725
AA seq 278 aa
MVGWRAAGGARAVLRRLSAAAEAAAKQDGRVFAASYSGSSGGVNAPFGLGQYANLLRAQA
FASRGVALNFHQLIRNAGISTTRNLLAADDAMVPVSSPLTPPLGDGEQTDKKGAIVKRLK
VQAIKKDIKQSPKKVNLVAKLVRGMRVEDALLQLQVTVKRAAKTVYQVIHSARANAAHNH
GLDPDKLIVEEAFVGKGLYLKRLSYHAKGRCGVMVRPRCRLTVVVREATAEEEAKIAKLR
VSNYKKLTRKEKQLMPHRLIEVSPRWARKRKEEAGAAA
NT seq 837 nt   +upstreamnt  +downstreamnt
atggtgggctggcgggcggcgggcggcgctcgtgccgttcttcgccggctcagcgcggcg
gcggaggcggcggcgaagcaggacggccgtgtgttcgctgccagctatagcggcagcagt
ggcggcgtgaatgctccgtttggcttgggccaatatgcaaaccttttgagggcacaagct
tttgcatccaggggagtcgcgctgaacttccatcagctgatccgcaatgctggaatatct
accacaaggaacctgcttgctgcagatgatgctatggttcctgtttcttctcctttgaca
cctccacttggtgatggagaacaaactgacaaaaagggagcaattgttaagcggctgaag
gtccaagccatcaagaaggatatcaagcagagccccaagaaggtgaatctggtagcaaag
ctggttcgaggaatgcgtgtggaagatgccctgttgcagttgcaagtgacagttaaaagg
gctgcaaaaactgtatatcaggtgattcattctgctcgtgccaatgcagctcacaatcac
ggactggatcctgataaacttattgtggaagaggcttttgttgggaaaggactttacctg
aagaggttgtcctaccatgccaaagggcggtgtggcgtcatggtgagaccgaggtgcaga
ctgacagtagtggttcgagaggctaccgctgaggaagaggcaaagatcgcgaaactcaga
gtcagcaactataagaagctgaccagaaaggagaagcagctaatgccgcaccgtcttatc
gaggttagcccgaggtgggctcgcaagaggaaagaggaggctggtgctgctgcgtag

DBGET integrated database retrieval system