KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131429
Entry
3131429           CDS       T01015                                 
Symbol
rpl33, OrsajCp049
Name
(RefSeq) ribosomal protein L33
  KO
K02913  large subunit ribosomal protein L33
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    3131429 (rpl33)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    3131429 (rpl33)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    3131429 (rpl33)
  Bacteria
    3131429 (rpl33)
SSDB
Motif
Pfam: Ribosomal_L33
Other DBs
NCBI-GeneID: 3131429
NCBI-ProteinID: NP_039407
UniProt: P0C455 P0C457 E9KIQ5
LinkDB
Position
Pltd:65198..65398
AA seq 66 aa
MAKGKDVRIRVILQCVSCVRKGANEESAGISRYSTQKNRHNTPGQLELRKFCRYCRKHTI
HAEIKK
NT seq 201 nt   +upstreamnt  +downstreamnt
atggccaaggggaaagatgttagaatcagagttattttgcaatgtgtgagttgtgttcga
aaaggggccaatgaggagtcggcagggatttctagatatagtactcaaaagaatcgccac
aatacacccggacaattagaattaagaaaattttgtcgttattgtcgtaagcatacgatt
catgccgaaataaagaaatag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268261
Entry
9268261           CDS       T01015                                 
Name
(RefSeq) 50S ribosomal protein L33
  KO
K02913  large subunit ribosomal protein L33
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    9268261
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    9268261
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    9268261
  Bacteria
    9268261
SSDB
Motif
Pfam: Ribosomal_L33
Other DBs
NCBI-GeneID: 9268261
NCBI-ProteinID: XP_015640154
UniProt: B9FL39 Q0DHP9
LinkDB
Position
5:22192248..22199543
AA seq 57 aa
MGKAKRASIFIRLVSAAGTGFFYVKRKNPRRITEKLEFRKYDPRVNKHVLFTEAKMK
NT seq 174 nt   +upstreamnt  +downstreamnt
atggggaaggcaaagcgtgcgtcgatttttatcaggcttgtttcagcagctggaaccggg
tttttctatgtgaagcgcaagaatcctcgtcggatcacagagaagcttgaatttaggaag
tatgatccacgagttaacaagcatgttctctttacagaagcaaagatgaagtga

DBGET integrated database retrieval system