KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131430
Entry
3131430           CDS       T01015                                 
Symbol
rpl36, OrsajCp061
Name
(RefSeq) ribosomal protein L36
  KO
K02919  large subunit ribosomal protein L36
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    3131430 (rpl36)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    3131430 (rpl36)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    3131430 (rpl36)
  Bacteria
    3131430 (rpl36)
SSDB
Motif
Pfam: Ribosomal_L36
Other DBs
NCBI-GeneID: 3131430
NCBI-ProteinID: NP_039419
UniProt: P62727 Q5N999 Q69X73
LinkDB
Position
Pltd:complement(76013..76126)
AA seq 37 aa
MKIRASVRKICTKCRLIRRRGRIRVICSNPKHKQRQG
NT seq 114 nt   +upstreamnt  +downstreamnt
atgaaaataagagcttctgttcgtaaaatttgtacaaaatgtcgactgattcgtaggcgt
ggacgaattagagtcatttgttccaatccgaagcataaacaaagacaggggtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334544
Entry
4334544           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4334544
  KO
K02919  large subunit ribosomal protein L36
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4334544
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4334544
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4334544
  Bacteria
    4334544
SSDB
Motif
Pfam: Ribosomal_L36 Arm-DNA-bind_4
Other DBs
NCBI-GeneID: 4334544
NCBI-ProteinID: XP_015631923
UniProt: B9F6X4 Q7XZF9
LinkDB
Position
3:complement(34001035..34002395)
AA seq 98 aa
MKVRASVKRLCAYCKVVKRRGIVFIQCKANAKHKQRQGFSTLAEAAAACHPPPPPLLTNT
SPAVAAAVAEASKVAKQEPSMKFNWPLGLAALLKNSDK
NT seq 297 nt   +upstreamnt  +downstreamnt
atgaaggttcgcgcgtcggtgaagcggctgtgcgcgtactgcaaggtggtgaagcgcagg
ggcatcgtgttcatccagtgcaaggccaacgccaagcacaagcagcgccagggcttctcc
acgctcgccgaggccgccgccgcctgccaccccccacctccgccgctgctcaccaacaca
tccccggctgtcgccgccgccgttgcggaggcctcgaaggttgctaagcaagagccgtct
atgaagtttaattggcctctgggtttagctgctctgctcaagaacagcgataaataa

DBGET integrated database retrieval system