KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131431
Entry
3131431           CDS       T01015                                 
Symbol
rpoA, OrsajCp059
Name
(RefSeq) RNA polymerase alpha subunit
  KO
K03040  DNA-directed RNA polymerase subunit alpha [EC:2.7.7.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    3131431 (rpoA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    3131431 (rpoA)
   03400 DNA repair and recombination proteins [BR:osa03400]
    3131431 (rpoA)
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     3131431 (rpoA)
Transcription machinery [BR:osa03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     3131431 (rpoA)
DNA repair and recombination proteins [BR:osa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      3131431 (rpoA)
SSDB
Motif
Pfam: RNA_pol_A_CTD RNA_pol_A_bac RNA_pol_L
Other DBs
NCBI-GeneID: 3131431
NCBI-ProteinID: NP_039417
UniProt: P0C498 P0C500 E9KIR2
LinkDB
Position
Pltd:complement(74330..75343)
AA seq 337 aa
MVREEVAGSTQTLQWKCVESRVDSKRLYYGRFILSPLRKGQADTVGIALRRALLGETEGT
CITHAKFGSVPHEYSTIAGIEESVQEILLNLKEIVLRSNLYGVRTASICVKGPRYITAQD
IILPPSVEIVDTAQPIANLTEPTDFRIELRIKRDRGYHTEVRKNTQDGSYPIDAVSMPVR
NVNYSIFACGNGNAKYEILFLEIWTNGSLTPKEALYEASRNLIDLFLPFLHTEEEGTRFQ
ENKNRFTSPLLSFQKRLTNLKKNKKRIPLNCIFIDQLELPSRTYNCLKRANIHTLLDLLS
KTEEDLMRIDSFRMQDGKQIWDTLEKHLPMDLPKNKF
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggttcgagaggaggtagcaggatccactcaaacactacagtggaagtgtgttgaatca
agagtagatagtaagcgtctttattatggtcgtttcattctgtccccgcttagaaaaggt
caagcggataccgttggtattgccttgcgaagagctttacttggagaaacagaaggaaca
tgtatcacacatgcaaaatttgggagcgtgccgcacgaatattctacaatagcaggtatt
gaagaatcggtacaagaaattttactaaatttgaaagaaattgtattgagaagtaatctc
tatggagttagaaccgcatcaatttgcgtcaaaggtcctagatacataactgcccaagat
attatcttaccgccttccgtagaaatcgttgatacggcacaacctatagctaacttgaca
gaacccacggatttccgtattgagttacggatcaagagagatcgcggatatcacacggaa
gtcagaaagaacactcaagatggaagttatcctatagatgctgtatccatgcctgttcga
aatgtgaattatagtatttttgcttgtgggaatggaaatgcaaaatatgagatacttttt
ctagaaatatggaccaatggaagtttaacccctaaggaagcgctttatgaggcttctcgt
aatttgattgatttatttcttccttttcttcacacggaggaagagggtactcgtttccaa
gaaaataaaaacaggtttacttccccccttttaagctttcaaaaaagattaactaatcta
aagaaaaacaaaaaaagaattccattgaattgtatttttattgatcaattagaactgcct
tctagaacgtataattgtctcaaaagggccaatatccatacactattggaccttttgagt
aagacggaagaagatctgatgagaattgacagttttcgtatgcaagatggaaaacagata
tgggacactctagagaagcatctcccaatggatttacctaagaataagttctag

DBGET integrated database retrieval system