KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131435
Entry
3131435           CDS       T01015                                 
Symbol
rps11, OrsajCp060
Name
(RefSeq) ribosomal protein S11
  KO
K02948  small subunit ribosomal protein S11
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    3131435 (rps11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    3131435 (rps11)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    3131435 (rps11)
  Bacteria
    3131435 (rps11)
  Archaea
    3131435 (rps11)
SSDB
Motif
Pfam: Ribosomal_S11
Other DBs
NCBI-GeneID: 3131435
NCBI-ProteinID: NP_039418
UniProt: P0C462 P0C464 E9KIR3
LinkDB
Position
Pltd:complement(75407..75838)
AA seq 143 aa
MTKAIPKIGSRRKVRIGLRRNARFSLRKSARRITKGVIHVQASFNNTIITVTDPQGRVVF
WSSAGTCGFKSSRKASPYAGQRTAVDAIRTVGLQRAEVMVKGAGSGRDAALRAIAKSGVR
LSCIRDVTPMPHNGCRPPKKRRL
NT seq 432 nt   +upstreamnt  +downstreamnt
atgacaaaagctataccaaaaattggttcacgtaggaaagtacgtattggtttgcgtagg
aatgcgcgttttagtttacggaagagtgcacgtagaataacaaaaggagttattcatgtt
caagctagtttcaacaatactattataactgttacagatccgcaaggtcgggtggttttc
tggtcctccgcgggtacttgtggattcaaaagctcaagaaaagcatcaccctatgctggt
caaagaacagctgtagatgctattcgtacagtgggtttgcaacgagcagaagttatggta
aagggtgctggtagtggaagagatgccgcattacgagccattgctaaaagtggtgtacga
ttaagttgtatacgcgatgtaacacctatgccgcataatgggtgtcgacctcctaaaaaa
agacgtctgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325316
Entry
4325316           CDS       T01015                                 
Name
(RefSeq) probable ribosomal protein S11, mitochondrial
  KO
K02948  small subunit ribosomal protein S11
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4325316
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4325316
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    4325316
  Bacteria
    4325316
  Archaea
    4325316
SSDB
Motif
Pfam: Ribosomal_S11 SnAC
Other DBs
NCBI-GeneID: 4325316
NCBI-ProteinID: XP_015638621
LinkDB
Position
1:24250007..24250737
AA seq 214 aa
TAAAAAFPPPQSKTASRMGLFSMPGGDTRQPSYGDRLMESQQLPQDYRANVPRSGDTMGL
RSRIAGGENPSYFGTPSHIFDEHKQSLVKGKRDFVYVLLKRNKTFVTVTDVRGNRKTGAS
AGCLEDKKGRSRLSKYATEATAEHVGRAARKMGLKSVVMKVKGTVFFNKKKKVILSFREG
FRGERVREQSPVVFIHDVTQLPHNGCRLPKQRLV
NT seq 645 nt   +upstreamnt  +downstreamnt
acggcggccgccgccgccttcccacctcctcagtctaaaaccgcttcacgtatgggtttg
ttctctatgcccggcggcgacacacgccaaccttcatatggagaccgtctcatggagtca
cagcagctgcctcaagactaccgtgccaatgtgccgcgttctggtgacacgatgggatta
aggtccaggatagctggtggcgagaatccctcctacttcgggaccccatcacacatcttt
gacgaacacaagcaatctctggtgaaagggaagagagattttgtctatgtcttgctcaag
agaaacaagacctttgtgaccgtgacagacgttcgggggaacagaaagaccggggcatcc
gctggttgtttggaggacaagaaagggcgctctcgtctctccaaatatgctactgaagca
accgcagaacatgtcgggcgagccgcgaggaagatgggtttgaaatccgtggtgatgaaa
gtgaaaggaactgtgttcttcaataagaagaagaaagtgatcctgagcttcagagaaggc
tttcggggtgaaagagtaagggagcaatctcctgtggtgtttatccacgatgtgacccag
cttccacacaacggatgccgcctcccgaaacaacgcctggtttag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4332994
Entry
4332994           CDS       T01015                                 
Name
(RefSeq) probable ribosomal protein S11, mitochondrial
  KO
K02948  small subunit ribosomal protein S11
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4332994
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4332994
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    4332994
  Bacteria
    4332994
  Archaea
    4332994
SSDB
Motif
Pfam: Ribosomal_S11 Synthase_beta
Other DBs
NCBI-GeneID: 4332994
NCBI-ProteinID: XP_015628011
UniProt: Q10KG1 Q0DRH1
LinkDB
Position
3:complement(15322142..15323963)
AA seq 332 aa
MHSLPPPAAASLPILLLLRRRRRREVHLCSGSGDTASEERRGGGEGVRVRPGLGTTSKPA
SPPVPLDPGRAFSGDLTAMASRRLFASLLRSTAAPRTPSTPGCLFNRAAAAAYSSSAPYN
GQGFPLPQSETASRLGLFSSPGDTRQPSYGDRLMQSQQLSQDYRARTQANNAPRFGDTMS
RIAGGENSSYFGTPSRIFDEHKQSLVKGKRDFVHVLLKRNKTFVTVTDVRGNKKTGASAG
CLEDRKGRSRLSKYAAEATAEHVGRAARKMGLKSVVMKVKGTTFFNKKKKVILSFREGFR
GERVREQSPVVLIHDVTQLPHNGCRLPKQRRV
NT seq 999 nt   +upstreamnt  +downstreamnt
atgcactccctcccacccccggccgccgcctctctccccatcctcctcctcctccgccgc
cgccgccgtcgggaagtacacctgtgctctggttccggcgacaccgcgagcgaggagagg
agaggtgggggtgagggagtgagggtgaggccggggttgggcaccaccagcaagccagcc
agcccccccgtccccttagatccgggccgggcgttctccggcgatctcacggccatggcg
tcccgccgcctcttcgcctccctcctcaggtccaccgcggcgccgcgcaccccgtccacg
cccgggtgcctcttcaaccgcgccgccgccgccgcctactcctcgtccgccccctacaac
ggccagggttttccacttcctcagtctgaaactgcttcacgtctgggtttgttctccagt
cccggcgacacacgccaaccttcatacggagaccgtctaatgcagtcacaacagctgagt
caagactaccgtgctaggacacaggccaataatgcgccacgttttggtgacacaatgtcc
aggatagctggtggcgagaactcttcctactttgggaccccatcacgcatctttgacgaa
cacaaacaatctttggtgaaaggaaagagagattttgtccatgtcttgctgaagagaaat
aagacctttgtgaccgtgacagacgttagggggaacaaaaagaccggggcatccgctggt
tgtttggaggacaggaaagggcgctctcgtctttccaaatatgctgctgaagcaactgca
gaacatgtcgggcgtgctgccaggaagatgggtttaaaatctgtggtcatgaaagtgaag
ggaactacatttttcaataagaagaagaaagtgatcctgagctttagagaaggctttcgg
ggtgaaagagtaagggagcaatctcctgtggtgctcatccacgatgtgacccaacttcca
cacaacggatgccgactccccaaacaacgccgggtttag

DBGET integrated database retrieval system