KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131440
Entry
3131440           CDS       T01015                                 
Symbol
rps18, OrsajCp050
Name
(RefSeq) ribosomal protein S18
  KO
K02963  small subunit ribosomal protein S18
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    3131440 (rps18)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    3131440 (rps18)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    3131440 (rps18)
  Bacteria
    3131440 (rps18)
SSDB
Motif
Pfam: Ribosomal_S18
Other DBs
NCBI-GeneID: 3131440
NCBI-ProteinID: NP_039408
UniProt: P0C477
LinkDB
Position
Pltd:65641..66132
AA seq 163 aa
MYTSKQPFHKSKQTFHKSKQTFRKSKQTFRKFKQPFRKPKQPFRRRPRIGPGDRIDYRNM
SLINRFISEQGKILSRRINRLTLKQQRLITLAIKQARILSFLPFRNYENEKQFQAQSISI
ITGPRPRKNRHIPPLTQKFNSNRNLRNSNQTLRNTNRNLSSDC
NT seq 492 nt   +upstreamnt  +downstreamnt
atgtatacatctaaacaaccctttcataaatccaaacaaacttttcataaatccaagcaa
acttttcgtaaatccaagcaaacttttcgtaaattcaaacaaccttttcgcaaacccaaa
caaccttttcgtaggcgtcctcggattggcccgggggatcgaattgattatagaaacatg
agtttaattaatcgatttattagtgaacaaggaaaaatattatcgagacgaataaataga
ttaaccttgaaacaacaacgattaattactcttgctataaaacaggctcgtattttatct
ttcttaccatttcgtaactatgagaatgagaaacaatttcaagcccagtcaatttcaata
attacaggtcctagacccagaaaaaatagacatattcctccattaacacaaaagttcaat
tccaatcgaaacttaagaaactccaaccagactttaagaaacaccaatcggaacttaagt
tccgattgttga

DBGET integrated database retrieval system