KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131441
Entry
3131441           CDS       T01015                                 
Symbol
rps19, OrsajCp112
Name
(RefSeq) ribosomal protein S19
  KO
K02965  small subunit ribosomal protein S19
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    3131441 (rps19)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    3131441 (rps19)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    3131441 (rps19)
  Archaea
    3131441 (rps19)
SSDB
Motif
Pfam: Ribosomal_S19
Other DBs
NCBI-GeneID: 3131441
NCBI-ProteinID: NP_039466
UniProt: P12153 E9KIS0
LinkDB
Position
Pltd:134200..134481
AA seq 93 aa
MTRKKTNPFVAHHLLAKIEKVNMKEEKETIVTWSRASSILPAMVGHTIAIHNGKEHIPIY
ITNPMVGRKLGEFVPTRHFTSYESARKDTKSRR
NT seq 282 nt   +upstreamnt  +downstreamnt
gtgacacgaaaaaaaacgaatccttttgtagctcatcatttattggcaaaaatagaaaag
gtcaatatgaaggaggagaaagaaacaatagtaacgtggtcccgggcatctagcattcta
cccgcaatggttggccatacaatcgcgattcataatggaaaggaacatatacctatttac
ataacaaatcctatggtaggtcgcaaattgggggaattcgtaccaactcggcatttcacg
agttatgaaagtgcaagaaaggatactaaatctcgtcgttaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 6450135
Entry
6450135           CDS       T01015                                 
Symbol
rps19, OrsajM_p37
Name
(RefSeq) ribosomal protein S19
  KO
K02965  small subunit ribosomal protein S19
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    6450135 (rps19)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    6450135 (rps19)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    6450135 (rps19)
  Archaea
    6450135 (rps19)
SSDB
Motif
Pfam: Ribosomal_S19
Other DBs
NCBI-GeneID: 6450135
NCBI-ProteinID: YP_002000582
UniProt: P92813
LinkDB
Position
MT:297685..297966
AA seq 93 aa
MPRRSIWKGSFVDAFLFRIKKNRESLMSRKIWSRRSSILPEFVDCSVLIYNGKTFVRCKI
TEGKVGHKFGEFAFTRRRRPYQTNRGKGRKGKK
NT seq 282 nt   +upstreamnt  +downstreamnt
atgccacgacgatctatatggaagggaagttttgttgatgctttcctgtttagaataaag
aagaacagagaaagtctgatgagcaggaaaatttggtcacgtagatcttctatttcgccg
gaattcgttgattgctccgtactcatttacaatggaaaaactcctgttcgttgtaagatc
actgaaggaaaggttggtcataaatttggagagtttgcttttacacggagacgaagaccc
tatcaaacaaatagaggaaagggcagaaaggggaaaaagtaa

DBGET integrated database retrieval system