KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131446
Entry
3131446           CDS       T01015                                 
Symbol
rps8, OrsajCp063
Name
(RefSeq) ribosomal protein S8
  KO
K02994  small subunit ribosomal protein S8
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    3131446 (rps8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    3131446 (rps8)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    3131446 (rps8)
  Archaea
    3131446 (rps8)
SSDB
Motif
Pfam: Ribosomal_S8 GAP1-N1
Other DBs
NCBI-GeneID: 3131446
NCBI-ProteinID: NP_039421
UniProt: P0C492 P0C494 E9KIR6
LinkDB
Position
Pltd:complement(76698..77108)
AA seq 136 aa
MGKDTIADLLTSIRNADMNKKGTVRVVSTNITENIVKILLREGFIESVRKHQESNRYFLV
STLRHQKRKTRKGIYRTRTFLKRISRPGLRIYANYQGIPKVLGGMGIAILSTSRGIMTDR
EARLNRIGGEVLCYIW
NT seq 411 nt   +upstreamnt  +downstreamnt
atgggcaaggacactattgctgatttactaacctctataagaaacgcggacatgaataaa
aaaggaactgttcgggtagtatctacaaatattaccgaaaacattgttaaaatacttcta
cgagagggttttattgaaagtgttcggaaacatcaggaaagtaacagatatttcttggtt
tcaactttgcgacatcaaaagagaaagactagaaagggaatatatagaactagaaccttt
ttaaagcgtatcagccgacctggcttacgaatttatgccaactatcaaggaattcctaag
gttttgggcggaatgggaattgctattctttctacttctcgaggtataatgacagatcga
gaagctcgactaaacagaattgggggagaagtcttatgttatatatggtaa

DBGET integrated database retrieval system