KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131457
Entry
3131457           CDS       T01015                                 
Symbol
rps4, OrsajCp027
Name
(RefSeq) ribosomal protein S4
  KO
K02986  small subunit ribosomal protein S4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    3131457 (rps4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    3131457 (rps4)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    3131457 (rps4)
  Archaea
    3131457 (rps4)
SSDB
Motif
Pfam: S4 Ribosomal_S4
Other DBs
NCBI-GeneID: 3131457
NCBI-ProteinID: NP_039385
UniProt: P0C486 P0C488 E9KIP2
LinkDB
Position
Pltd:complement(44810..45415)
AA seq 201 aa
MSRYRGPRFKKIRRLGALPGLTRKTPKSGSNLKKKFHSGKKEQYRIRLQEKQKLRFHYGL
TERQLLRYVHIAGKAKSSTGQVLLQLLEMRLDNILFRLGMASTIPEARQLVNHRHILVNG
RIVDIPSFRCKPRDIITTKDNQRSKRLVQNSIASSDPGKLPKHLTIDTLQYKGLVKKILD
RKWVGLKINELLVVEYYSRQT
NT seq 606 nt   +upstreamnt  +downstreamnt
atgtcccgttatcgaggacctcgttttaaaaaaatacgccgtctgggagctttaccagga
ctcactagaaaaacacctaaatccggaagtaatctgaaaaagaaattccattctgggaaa
aaagaacaatatcgtattcgtcttcaagaaaaacagaaattgcgttttcattatggtctg
acagaacgacaattacttagatatgtacatatcgctggaaaagcaaaaagttcaacaggt
caggttttactacaattacttgaaatgcgtttggataatatcctttttcgattaggtatg
gcttcaaccattcccgaggcccggcaattagttaaccatagacatattttagttaatggt
cgtatagtcgatataccaagttttcgttgcaaaccccgagatattattactacgaaggat
aaccaaagatcaaaacgtctggttcaaaattctattgcttcatccgacccggggaaattg
ccaaagcatttgacgattgacacattgcaatataaaggactagtaaaaaaaatcctggat
aggaagtgggtcggtctcaaaataaatgagttgttagttgtagaatattactctcgtcaa
acttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 6450179
Entry
6450179           CDS       T01015                                 
Symbol
rps4, OrsajM_p32
Name
(RefSeq) ribosomal protein S4
  KO
K02986  small subunit ribosomal protein S4
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    6450179 (rps4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    6450179 (rps4)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    6450179 (rps4)
  Archaea
    6450179 (rps4)
SSDB
Motif
Pfam: S4
Other DBs
NCBI-GeneID: 6450179
NCBI-ProteinID: YP_002000578
UniProt: Q8HCN9
LinkDB
Position
MT:complement(248580..249638)
AA seq 352 aa
MPALRFKTCRLLLGNVWNRELSLIQRRILRRLRNKRRSIKRNLSQRENLNSNIKLQTTRK
LSLYYGDLPIREMHRGRERTSYIPFLLNQETRLDVILVRLHFCDTLPQARQLISHRRVCL
NNGLVTITHLKVSHGDLISFQENDARTRGEEIRRSFYIDILVGKIIGKLLPVRIWRKTKT
EWFRLLTTQRVCRLLLKSWFLQELRSYMQEEDLERTKKFGSAKVCLGSSFAEHNRMKRNL
FHFKYFFLLKRRKEEEELIRTIGEAENRKRAISPFVYKSSLYRNSTYCSGSPFTRKIRIK
RIELPTHYLEVNYRTLKAVVFYGPNIGHIPHDIRLKDLNLLLWSGNGRGQNI
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgcctgcattaagatttaaaacgtgtcgtctacttccaggaaatgttcggaacagagaa
ctttctctaatccaacgccgcattctccgaagattgaggaacaagaggagatccattaaa
agaaatctttctcagagagaaaatctaaacagtaacatcaaatcacaaactacacgaaag
ttgtccctttattatggggatttacccataagggagatgcacagaggaagagaacgaact
tcatatatcccttttttactcaatcaagaaacaagatcggacgtgattccggttcgtctc
catttttgtgacactcttcctcaagcaaggcagccgataagtcatcgaagggtttgtttg
aataatggactggtaaccattactcatttgaaagtttcccacggtgatctaatatctttt
caagaaaatgacgcgagaacccgcggtgaagaaataaggagatctttctatatcgacata
tcagttggaaaaatcataggcaaattactaccggtcagaatctggagaaaaacaaaaaca
gaatggttccgcttactcacaactcagagggtatgccgcttactactcaaatcctggttt
ttgcaagagttgcgttcttatatgcaagaagaagacttagaaagaacaaagaagtttgga
tccgcaaaagtatgcttaggcagttccttcgctgagcacaacagaatgaagaggaatttg
tttcatttcaaatacttcttcttattgaaaagaaggaaggaggaagaggaattgataaga
acaataggggaagcggaaaaccgaaaaagagcaataagtccttttgtttacaagtcttct
ttatatagaaattcgacctattgctccggatccccgtttactaggaagataagaatcaaa
aggatcgaactacctactcattattcggaggtgaatcatagaacactaaaagctgtggta
tcttatggacctaacataggtcacatccctcacgacataagattgaaagatccaaacctt
cctcttcggagcggaaacggacgtggccaaaacatataa

DBGET integrated database retrieval system