KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131461
Entry
3131461           CDS       T01015                                 
Symbol
atpE, OrsajCp031
Name
(RefSeq) ATP synthase CF1 epsilon subunit
  KO
K02114  F-type H+-transporting ATPase subunit epsilon
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00190  Oxidative phosphorylation
osa00195  Photosynthesis
osa01100  Metabolic pathways
Module
osa_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    3131461 (atpE)
   00195 Photosynthesis
    3131461 (atpE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:osa00194]
    3131461 (atpE)
Photosynthesis proteins [BR:osa00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   3131461 (atpE)
SSDB
Motif
Pfam: ATP-synt_DE_N ATP-synt_DE DUF6324
Other DBs
NCBI-GeneID: 3131461
NCBI-ProteinID: NP_039389
UniProt: P0C2Z1 P0C2Z3 E9KIP6
LinkDB
Position
Pltd:complement(51404..51817)
AA seq 137 aa
MKLNLYVLTPKRIIWDCEVKEIILSTNSGQIGVLPNHAPINTAVDMGPLRIRLLNDQWLT
AVLWSGFARIVNNEIIILGNDAELGSDIDPEEAQQALEIAEANVSRAEGTKELVEAKVAL
RRARIRVEAVNWIPPSN
NT seq 414 nt   +upstreamnt  +downstreamnt
atgaaattaaatctttatgtactgactcctaagcgaattatttgggattgtgaagtgaaa
gaaatcattttatctactaatagtggccaaattggcgtattaccaaaccacgcccccatt
aacacagctgtagatatgggtcccttgagaatacgcctcctcaacgatcaatggttaacg
gcggttctgtggagcggttttgccagaatagttaataatgagatcatcattttaggaaat
gatgcggaactgggtagtgacattgatccggaagaagctcaacaggcacttgaaatagcc
gaagctaacgtgagtagagctgagggtacgaaagaattggttgaagcgaaggtagctctc
agacgagctaggatacgagtcgaggctgttaattggattcccccatctaattga

DBGET integrated database retrieval system