KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131462
Entry
3131462           CDS       T01015                                 
Symbol
atpB, OrsajCp032
Name
(RefSeq) ATP synthase CF1 beta subunit
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00190  Oxidative phosphorylation
osa00195  Photosynthesis
osa01100  Metabolic pathways
Module
osa_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    3131462 (atpB)
   00195 Photosynthesis
    3131462 (atpB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:osa00194]
    3131462 (atpB)
Enzymes [BR:osa01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     3131462 (atpB)
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     3131462 (atpB)
Photosynthesis proteins [BR:osa00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   3131462 (atpB)
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N AAA ATPase T3SS_ATPase_C ATPase_2 AAA_25 RsgA_GTPase ABC_tran AAA_16 RNA_helicase AAA_19 NB-ARC
Other DBs
NCBI-GeneID: 3131462
NCBI-ProteinID: NP_039390
UniProt: P12085
LinkDB
Position
Pltd:complement(51814..53310)
AA seq 498 aa
MRTNPTTSRPGVSTIEEKSTGRIDQIIGPVLDVTFPRGKLPYIYNALVVKSRDTDGKQIN
VTCEVQQLLGNNRVRAVAMSATDGLMRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDN
LGPVDTSATFPIHRSAPAFIELDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTV
LIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEKNLEESKVALVYGQMN
EPPGARMRVGLTALTMAEYFRDVNKQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQP
TLSTEMGSLQERITSTKKGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLASKG
IYPAVDPLDSTSTMLQPRIVGNEHYETAQRVKQTLQRYKELQDIIAILGLDELSEEDRLT
VARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNI
DEASTKAINLEEENKLKK
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgagaaccaatcctactacttctcgtcccggggtttctacaattgaagaaaaaagtaca
gggcgtatcgatcaaattattggacccgtgctggatgtcacttttccccggggcaagtta
ccttatatttataatgctttggtagtcaagagtcgagacactgacggtaagcaaattaat
gtaacttgtgaggtacaacaattattaggaaataatcgagttagagctgtagctatgagt
gctacagatgggttgatgagaggaatggaagtgattgacacgggagctcctctcagtgtt
cctgtcggtggagctactcttggacgaattttcaacgttcttggggagcctgttgacaat
ttgggtcctgtagatactagtgcaacattccctattcatagatccgcgcccgcctttatc
gagttagatacgaaattatccatctttgaaactggtattaaggtggtcgatcttttagct
ccttatcggcgtggaggaaaaatcggactatttgggggagctggagtaggtaaaacagta
ctcatcatggaattaatcaacaatattgctaaagctcacgggggcgtatccgtatttggc
ggagtaggggaacggactcgtgaaggaaatgatctttatatggaaatgaaggaatctgga
gtaattaatgaaaaaaatcttgaggaatcaaaggtagctctagtctatggccaaatgaat
gaaccgccaggagctcgtatgagagttggtttgactgccctaactatggcagaatatttc
cgagatgttaataagcaagacgtgcttctattcatcgataatatctttcgttttgttcaa
gcaggatcggaggtatctgccttattagggagaatgccctctgcagtgggttatcaacct
actcttagtacagaaatgggttctttgcaagaaagaattacttctactaaaaagggatct
ataacttcgatccaagcggtttatgtacctgcggacgatttgaccgaccctgctcctgct
acaacatttgcacatttggatgctactaccgtactttccagaggattagcttccaaaggg
atttatcctgcagtagatcctttagattcaacctcaactatgttacaacctcggatcgtt
ggcaacgaacattatgaaactgcgcaaagagttaagcaaactttacaacgttacaaagaa
cttcaggacattatcgcaattcttgggttggatgaattatcggaggaggatcgtttaact
gtagcaagagcacgaaaaattgagcgcttcttatcacaaccgttttttgtggcagaagtt
tttaccggttctccgggaaagtatgttggtcttgcagaaactattaggggatttcaacta
atcctttccggagaattagacggcctacccgaacaggctttttatttggtgggtaacatc
gatgaagctagcacgaaagctataaacttagaagaggagaacaaattgaagaaatga

DBGET integrated database retrieval system