KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 3131486
Entry
3131486           CDS       T01015                                 
Symbol
rpl32, OrsajCp086
Name
(RefSeq) ribosomal protein L32
  KO
K02911  large subunit ribosomal protein L32
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    3131486 (rpl32)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    3131486 (rpl32)
   03029 Mitochondrial biogenesis [BR:osa03029]
    3131486 (rpl32)
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    3131486 (rpl32)
  Bacteria
    3131486 (rpl32)
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    3131486 (rpl32)
SSDB
Motif
Pfam: Ribosomal_L32p HECA
Other DBs
NCBI-GeneID: 3131486
NCBI-ProteinID: NP_039442
UniProt: P0C452 P0C454 E9KIS7
LinkDB
Position
Pltd:104352..104543
AA seq 63 aa
MAVPKKRTSMSKKRIRKNLWKKKTYFSIVQSYSLAKSRSFSGVSEHPKPKGFSRQQTNNR
VLG
NT seq 192 nt   +upstreamnt  +downstreamnt
atggcagttccaaaaaaacgtacttcgatgtcaaaaaagcgtattcgtaaaaatctttgg
aagaaaaagacttatttttccatagtacaatcttattctttagcaaaatcaagatcattt
tctggcgtcagcgagcatccaaaaccaaagggtttttctcggcaacaaacaaataatagg
gttttgggataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4331759
Entry
4331759           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4331759
  KO
K02911  large subunit ribosomal protein L32
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4331759
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4331759
   03029 Mitochondrial biogenesis [BR:osa03029]
    4331759
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4331759
  Bacteria
    4331759
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    4331759
SSDB
Motif
Pfam: Ribosomal_L32p
Other DBs
NCBI-GeneID: 4331759
NCBI-ProteinID: XP_015630740
UniProt: A3AEJ2 Q8S7V4
LinkDB
Position
3:3711091..3713255
AA seq 113 aa
MAAAAGWLRRAAAAAAAPRLPSGLPILPTPPPAPLTEAQSFVLPGIGTAVAGGMDLMAVP
KKKVSKYKKGLRNGPKALKPVPVIVRCRCCGRVKLPHFYCCSGEKGNPGDSSS
NT seq 342 nt   +upstreamnt  +downstreamnt
atggcggcggcggcgggttggctccggcgagcggcagcggcggcggcggcgcctcgcctg
ccttcaggccttcctatactacctactccccctccagcccctctcacagaggcccaatcg
ttcgtgctcccgggcataggcaccgccgtcgccggcggcatggacctcatggccgttccc
aagaaaaaggtctcaaaatacaagaagggtttgaggaatggaccgaaagcattgaagccg
gttccagtgattgtccgttgcaggtgctgtggccgagtgaagctgccccacttctactgc
tgtagcggagaaaaagggaaccccggcgactcaagctcataa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4348590
Entry
4348590           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4348590
  KO
K02911  large subunit ribosomal protein L32
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4348590
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4348590
   03029 Mitochondrial biogenesis [BR:osa03029]
    4348590
Ribosome [BR:osa03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    4348590
  Bacteria
    4348590
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    4348590
SSDB
Motif
Pfam: Ribosomal_L32p
Other DBs
NCBI-GeneID: 4348590
NCBI-ProteinID: XP_015614301
UniProt: Q7XEU1 A3C4L5
LinkDB
Position
10:complement(13937399..13939567)
AA seq 117 aa
MAAAAAASSGWLRRAAGTVPRIPCGLVTALVPTPPPPAAAVVSEAPALALPSHAAVAMEL
MAVPKKKVSKYKKGLRNGPKALKPVPVIVRCKCCGRVKLPHFYCCSGERGNPGSESS
NT seq 354 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcctcctcgggctggctccggcgagcggcggggacagtcccg
cgcattccatgcggactcgtgaccgcactcgtcccgacccctcctccacccgctgctgcg
gtggtgtccgaggcccccgcgctcgcgctcccttcccacgccgccgtcgccatggagctc
atggctgttcccaagaagaaggtttcaaagtataagaagggcctgaggaatgggccaaaa
gccctgaagcctgttcctgtaattgtccgctgcaagtgctgcggtcgggtgaagctgcca
cacttctactgttgcagcggcgaaagagggaaccctggatctgagagctcgtaa

DBGET integrated database retrieval system