KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4323853
Entry
4323853           CDS       T01015                                 
Name
(RefSeq) DNA repair protein RAD51 homolog 3 isoform X1
  KO
K10870  RAD51-like protein 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4323853
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4323853
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     4323853
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     4323853
SSDB
Motif
Pfam: Rad51 AAA_25 ATPase DnaB_C RecA AAA_24 APOBEC4 DnaJ
Other DBs
NCBI-GeneID: 4323853
NCBI-ProteinID: XP_015626410
UniProt: Q0JLS0 Q9AWX8
LinkDB
Position
1:complement(22353410..22358413)
AA seq 349 aa
MEIADLPIATSHRANLLAAGYSSLAALSAASPPRLARDLSIEVHEAEEILKVAVGANKSK
GADGPSTSSVLKGVQNAWDMLSDEQSRRHINTGSADLNNILGGGIHCKEVTEIGGVPGVG
KTQLGIQLAINVQIPVEYGGLGGKAVYIDTEGSFMVERVYQIAEGCISDILEYFPHCHDK
APAGQEKLKPESFLADIYYFRICSYTEQIAVINYLEKFLGEHKDVRIVIIDSVTFHFRQD
FDDMALRTRVLSGLSLKLMKLSKAYNLAVVLLNQVTTKFTEGSFQLTLALGDSWSHSCTN
RLILYWNGNERYGFLDKSPSLPVASAPYAVTVKGVRDAVNSNSKRVRVM
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggagatcgccgacctccccatcgccacctcccaccgcgccaacctcctcgccgccggc
tactcctccctcgccgcgctctccgccgcctcccctccccgcctcgcccgagatttgagc
attgaggtacatgaggctgaagaaatcctcaaggttgccgtgggcgccaacaagtccaag
ggagcagatgggcctagcaccagcagtgttctcaaaggtgtgcaaaatgcatgggatatg
ctatctgatgagcaatcacggaggcacatcaatactggatctgctgacctcaacaacatc
cttggtggagggattcactgtaaagaggttactgagattggtggtgtcccaggagtcggt
aaaactcaactggggattcaactagcaatcaatgttcaaattccagtggagtatggtgga
cttggtgggaaagctgtttatatagatacagagggaagtttcatggttgaacgtgtctac
caaattgctgaagggtgcatcagtgatatactggagtactttccacactgccatgacaag
gctccagccggacaagaaaaactgaagcctgagagtttcctggctgacatctactacttt
cgaatatgcagctatactgaacaaattgcagtcataaactatctggaaaagtttcttggg
gagcataaagatgtaagaatagttattattgacagcgttactttccactttcggcaagat
tttgatgatatggcactaaggactagagtgcttagtggattatcattgaagttgatgaaa
ctttcaaaggcatataacttggcggttgtcttgttgaaccaagttactactaaattcaca
gaaggatcatttcagttaactcttgctctaggtgacagttggtcccactcatgcaccaat
cgactaattctgtattggaacggcaatgagcggtatggattcctggacaagtccccttca
ctaccagtagcatcagcaccatatgcagtgacagttaaaggggtgagagatgctgtgaat
tcaaacagcaagcgagtccgggtaatgtag

DBGET integrated database retrieval system