KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4323866
Entry
4323866           CDS       T01015                                 
Name
(RefSeq) aspartate aminotransferase
  KO
K00837  aromatic aminotransferase [EC:2.6.1.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00270  Cysteine and methionine metabolism
osa00380  Tryptophan metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    4323866
   00380 Tryptophan metabolism
    4323866
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-
     4323866
SSDB
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5 Alliinase_C Beta_elim_lyase
Other DBs
NCBI-GeneID: 4323866
NCBI-ProteinID: XP_015616144
UniProt: A0A0N7KCF8 A2ZPW5
LinkDB
Position
1:complement(4051870..4057711)
AA seq 394 aa
MGSFGRLARRAVETEAPVMVKMQELLRGNKDVMSLAQGVVYWQPPEAAMNKIKEIVWEPS
ISKYGSDDGLPELREALLEKLRRENKLTKSSIMVTSGANQAFVNVVLTLCDAGDAVVMFA
PYYFNSYMSFQMTGVTDILVGASNPETLHPDVDWLEKVLQENNPIPKLVSVVNPGNPSGA
FIPKPMLERISELCRNAGAWLVVDNTYEYFMYDGMEHYCLEGNHIVNLFSFSKAYGMMGW
RVGYIAHPNEADGLHAQLLKVQDNIPICASIIGQRLALYALEAGPEWIRERVRDLVKNRE
LLMEAMSPLGKDSVKGGEGAIYLWAKLPEKCSDDFEVVRWLANKHGVAVIPGSASGGPGY
IRVSFGGLKESDTRLAAERLRRGLQELVTEGMVQ
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgggtagcttcgggaggctggcgaggagggccgtggagacggaagcgccggtcatggtc
aagatgcaggaattgcttcgagggaacaaggatgtgatgtcgcttgcgcagggagttgtt
tattggcagcctcctgaggcagctatgaataagattaaagaaattgtatgggaaccatca
atcagtaaatatggctctgatgatggtcttcctgaactccgagaagcacttctcgagaag
ctgcgcagagagaataagctaaccaagtcgtcaattatggttacctctggtgcaaatcag
gcctttgtaaatgtggtcctcaccctttgtgatgctggggatgcagttgtcatgtttgca
ccatattacttcaattcctacatgtcattccagatgacaggagttactgacatattagtt
ggtgcaagcaatcctgagactcttcatcctgatgtcgattggttggagaaggttctgcaa
gaaaacaaccctatccctaaacttgttagtgttgtaaatcctggaaacccctctggagct
ttcattccgaagccgatgctcgaaagaatttcagaactgtgcagaaatgctggtgcatgg
cttgtagttgacaatacctatgagtactttatgtatgatggaatggagcactattgctta
gagggtaatcacattgtcaacctcttctcattctcgaaggcttacggaatgatgggctgg
cgtgtaggatacattgcccacccaaacgaagctgacggtcttcatgcacagctgctcaaa
gtgcaagataacatacctatctgtgcttccatcatcgggcagcgcctggcgctctacgca
ttagaggctggtccagaatggatcagagaaagggtgagagatctagtgaaaaaccgtgaa
ttgctcatggaagcgatgtctccgcttggcaaggactctgtcaagggtggtgagggtgcc
atttacctctgggcaaaactacccgagaaatgctcagatgattttgaagttgtcagatgg
cttgcaaacaagcatggtgtggctgtgatccccgggagcgccagtggaggtcccggatat
atccgggtttctttcggagggttgaaagaatcggatacaaggcttgctgctgagaggtta
aggcgcggcttgcaagaacttgtgactgagggaatggtacagtga

DBGET integrated database retrieval system