KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4323939
Entry
4323939           CDS       T01015                                 
Name
(RefSeq) protoheme IX farnesyltransferase, mitochondrial
  KO
K02257  heme o synthase [EC:2.5.1.141]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00190  Oxidative phosphorylation
osa00860  Porphyrin metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4323939
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    4323939
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:osa01006]
    4323939
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:osa03029]
    4323939
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.141  heme o synthase
     4323939
Prenyltransferases [BR:osa01006]
 Compound prenylation
  Protoheme farnesyltransferase
   4323939
Mitochondrial biogenesis [BR:osa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    4323939
SSDB
Motif
Pfam: UbiA TMEM100
Other DBs
NCBI-GeneID: 4323939
NCBI-ProteinID: XP_015622414
UniProt: Q5QLH9 Q5QM47
LinkDB
Position
1:complement(18961331..18969000)
AA seq 467 aa
MPSPKVHSSPSFLLPHFVPTCSSPDPSAAAAAMWRGGATAASAARALRSRLIPDTSHHPA
TALAPIASPRSSSSSSSSSAPTIAAAVPAVAEATAAAAAVSRQAGSVSDALRHYGRCYFE
LSKARLSALVVATSGAGYVLGSGNMVDIAGLCCTCAGTMMVAASANTLNQVFEIKNDAKM
KRTMRRPLPSGRISPAHAAMWATSVGVAGTALLAWKANGLAAGLAASNLILYAFVYTPLK
QIHPVNTWVGAVVGAIPPLLGWAAASSELSLNAMILPAALYYWQIPHFMALAYLCRNDYL
AGGYRMFSFADPTGKRTAWVSLRNCLYMLPLGFFAYNWGLTSEWFSLEASLLTLGLTIGA
LSFVLEPTPKTARRMFYGSLLYLPAFMAGLLLHRLPNEQKEHNVTQTSEITGILYGAEQQ
DEERARQKREDRKPSRIHSRPPVAYASVAPFPFLPVPIYVSTQGHEL
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgccatctccaaaagtccactcctcgccttcgtttctcctcccccatttcgtccctacc
tgctcctcaccagatccttccgccgccgccgccgccatgtggaggggcggcgcgaccgcc
gcctccgccgcgagggctctccgctcgcgcctgatccccgacacgtcccaccacccggcc
acggctctagctcccatcgcatcgccgcgctcctcctcctcctcctcctcctcgtctgcc
cccaccatcgccgccgctgtgcccgccgtcgcggaggctacggcggccgcggccgctgtt
tcgaggcaagctggatccgtctccgacgcgctgaggcactacgggaggtgctacttcgag
ctctccaaagcccgcctaagtgcccttgttgtggcaacatctggggctggttatgtgctc
ggaagtggcaacatggtagacatagctggactttgttgcacctgcgctggtaccatgatg
gttgcagcatctgcaaatactctcaaccaggtgtttgagataaagaatgacgctaaaatg
aaaagaaccatgcgacggcccctaccatcagggcgcattagtcctgcacatgctgccatg
tgggctactagtgttggagttgctggaacagctttgttggcttggaaggctaatggcttg
gcggctgggctcgcagcttctaatcttattctgtatgcatttgtatacacaccattgaag
caaatacaccctgtaaatacatgggttggagcagttgttggtgccataccaccacttcta
gggtgggcagcagcttcgtctgaactgtcactgaatgctatgattctccctgctgcattg
tactattggcaaataccacattttatggcccttgcatacttatgtcggaatgattacctt
gctggagggtaccgaatgttttcttttgctgatcctactggtaaaagaactgcatgggta
tcactcagaaattgtctatacatgctgcccttgggattttttgcatacaactggggtctc
acatctgagtggttcagtcttgaagcatcacttctaactttgggccttacaattggagct
ctatcatttgtgctggagccaacccccaaaactgcaaggagaatgttctatggtagcctt
ttgtatcttcctgcttttatggctggacttctgttgcatcggctgcctaatgagcaaaag
gagcataatgtcactcagacgagtgaaatcaccggaattctttatggtgctgaacagcag
gatgaagaacgagctagacagaagcgtgaggaccgaaaaccttctcgtattcactcgcgc
cctccggttgcctatgcttctgtggccccttttcctttcttaccagtacctatatatgtc
tctacccaaggtcatgagctatga

DBGET integrated database retrieval system