KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324023
Entry
4324023           CDS       T01015                                 
Name
(RefSeq) mitogen-activated protein kinase kinase 1 isoform X3
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4324023
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:osa01001]
    4324023
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     4324023
Protein kinases [BR:osa01001]
 Serine/threonine kinases: STE group
  STE7 family
   4324023
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Pkinase_fungal Kinase-like APH RIO1 Seadorna_VP7
Other DBs
NCBI-GeneID: 4324023
NCBI-ProteinID: XP_015621394
UniProt: Q5QN75
LinkDB
Position
1:17904780..17910001
AA seq 355 aa
MRGKKPHKELKLSVPAQETPVDKFLTASGTFKDGELRLNQRGLQLISEETADEPQSTNLK
VEDVQLSMDDLEMIQVIGKGSGGIVQLVRHKWVGTLYALKGIQMNIQEAVRKQIVQELKI
NQATQNAHIVLCHQSFYHNGVIYLVLEYMDRGSLADIIKQVKTILEPYLAVLCKQVLEGL
LYLHHERHVIHRDIKPSNLLVNRKGEVKITDFGVSAVLASSMGQRDTFVGTYNYMAPERI
SGSSYDYKSDIWSLGLVILECAIGRFPYIPSEGEGWLSFYELLEAIVDQPPPSAPADQFS
PEFCAFISSCIQKDPAERMSASELLNHPFIKKFEDKDLDLRILVESLEPPMNISE
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgagggggaagaagccgcacaaggagctcaagctctccgtgcctgcgcaggagacgccc
gtcgacaagttcctgaccgcgagtggtacattcaaggatggtgaactgcggcttaatcaa
agaggtttgcagcttatatccgaggaaactgcagatgaacctcagtcaacaaacctgaag
gtggaagatgttcagttgtcaatggatgaccttgagatgattcaagtcattggtaagggg
agtggtggtatcgtccaactagttcggcacaagtgggtggggacattatatgccttgaag
ggcatacaaatgaacattcaagaggcagttcgcaaacaaatagtacaagagctcaaaata
aatcaagcaacacagaacgcacatatagtcctttgccaccaatctttctaccataatggt
gtaatatatcttgttctagaatacatggaccgtggatctcttgcagatatcattaaacaa
gtcaaaacaattctggagccatacctggcagtactttgcaaacaggttttggagggtcta
ctgtatcttcatcatgaaaggcatgtgattcacagggatataaagccatctaacttgtta
gttaaccgtaaaggtgaagtaaagattaccgattttggggtaagtgcggtgctagcaagt
tcaatgggtcagcgggatacgtttgttggaacctacaactatatggcgcctgagcgtatt
agtggaagctcctatgactacaagagtgacatatggagtttgggcttagtaatactcgag
tgtgccattggtcggttcccctatataccttcagaaggggaaggttggttaagcttctac
gaattattagaagcaattgttgaccagccaccaccctctgcaccagcggaccagttctct
ccagaattttgtgcatttatctcctcctgcatacaaaaggatcctgcggagcggatgtct
gcttcagaactcttgaatcatcctttcatcaagaagtttgaggataaggatttagacctg
cgcattcttgtcgagagccttgaacctccaatgaatatatccgagtaa

DBGET integrated database retrieval system