KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324027
Entry
4324027           CDS       T01015                                 
Name
(RefSeq) transcription initiation factor TFIID subunit 6
  KO
K03131  transcription initiation factor TFIID subunit 6
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4324027
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4324027
   03036 Chromosome and associated proteins [BR:osa03036]
    4324027
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     4324027
   Coactivators
    SAGA/TFTC/STAGA complex
     4324027
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    PCAF complex
     4324027
    STAGA complex
     4324027
    TFTC complex
     4324027
    SAGA complex
     4324027
    SLIK complex
     4324027
SSDB
Motif
Pfam: TAF6_C TAF Histone TFIID-31kDa CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 4324027
NCBI-ProteinID: XP_015621355
UniProt: A0A0N7KD18 Q8LRG9
LinkDB
Position
1:complement(17960865..17968598)
AA seq 541 aa
MSIVPKETIEVIGQSVGIANLPADVSAALAPDVEYRLREIMQEAIKCMRHAKRTVLTADD
VDSALSLRNVEPVYGFASGDPLRFKRAVGHKDLFYIDDREVDFKEIIEAPLPKAPLDTAV
VAHWLAIEGVQPAIPENPPVDAIVAPTENKRTEHGKDDGLPVDIKLPVKHVLSRELQMYF
DKIAELTMSRSETSVFREALVSLSRDSGLHPLVPYFSYFIADEVTRSLGDLPVLFALMRV
VQSLLHNPHIHIEPYLHQLMPSIITCMVAKRLGHRLSDNHWELRDFSANLVGSVCRRFGH
AYHNIQTRVTRTLVQGFLDPQKSLTQHYGAIQGISALGPSAIRLLLLPNLETYMQLLEPE
LQLDKQKNEMKRKEAWRVYGALLCAAGKCLYDRLKLFPNLLSPSTRPLLRSNKRVVTNNP
NKRKSSTDLSTSQPPLKKMTTDGAMNSMTSAPMPGTMDGFSTQLPNPSMTQTSSSGQLVE
STASGVIRRDQGSNHTQRVSTVLRLAWKEDQNAGHLLSSLYEVFGEAIFSFVQPPEISFF
L
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgagcatagtgcccaaagagacgattgaggtgatcgggcagagcgtcggcatcgccaac
ctccccgccgatgtctccgccgcgctcgcccccgacgtggagtaccgcctccgcgagatc
atgcaggaggccatcaagtgtatgcggcatgcaaagaggacagtcctgactgccgatgat
gttgatagtgctctcagcctcaggaatgttgagcctgtatatggatttgcttccggtgac
cccttgcggtttaagagagctgtgggacacaaggatctcttctatattgatgacagggag
gtagacttcaaagagattattgaggcccctctacctaaagctcctcttgatacagcagtt
gtagctcactggctagccattgagggagtccagcctgcaattccagagaatcctcctgta
gatgctatcgtagcaccaacagagaataaaaggacagagcatgggaaagatgatggactt
cctgttgacatcaagcttcctgttaagcatgtgttatctagagaactccagatgtatttt
gataaaatagcagagcttacaatgagtagatctgaaacctcagtttttagagaagcatta
gtgagcttatcaagagactcaggccttcatccgttggttccttacttttcctacttcatc
gccgatgaggttacccggagtttaggtgatcttcctgttttatttgctctcatgcgtgta
gtccaaagcctcctacacaatccccacattcatattgaaccatatttgcatcagttgatg
ccgtcaattatcacctgcatggttgcgaaaaggcttgggcataggctttcagacaaccat
tgggagcttagagacttctctgctaatttggttggttcagtatgtcgaaggtttggtcat
gcgtatcacaacatccaaacccgggtgacaaggacgttggtccagggatttcttgatcct
cagaaatcattgacacaacactatggtgcgattcaagggatatctgcattggggcccagt
gcaattaggcttctgcttttgcccaacctcgagacatacatgcagcttttagagccggaa
ttacaacttgataagcagaaaaatgagatgaaaagaaaggaagcatggcgtgtttatggt
gccctgctgtgtgctgcaggaaaatgcttatatgatcggctcaagttgtttcctaatttg
ctttctccatcaacacggcctcttttgaggagtaataagagagtcgtgactaacaaccca
aataaacggaagtctagtacagatctctccacatcccagccacctctgaagaagatgaca
acagatggtgcgatgaattctatgacttcagctcccatgccaggaaccatggatggcttc
tccacccaattacccaaccctagcatgacgcaaacttcatcctctgggcaattggtggaa
agcaccgcatcaggtgtgattcggagggatcagggaagcaaccacacgcaaagagtttcc
acagtgctgaggctagcctggaaggaggaccaaaatgctgggcatctgttgagttcattg
tacgaggtattcggtgaagccatcttctcctttgttcaaccaccagagatatcgttcttt
ttgtag

DBGET integrated database retrieval system