KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324401
Entry
4324401           CDS       T01015                                 
Name
(RefSeq) D-glycerate 3-kinase, chloroplastic isoform X1
  KO
K15918  D-glycerate 3-kinase [EC:2.7.1.31]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00561  Glycerolipid metabolism
osa00630  Glyoxylate and dicarboxylate metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
Module
osa_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    4324401
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    4324401
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4324401
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.31  glycerate 3-kinase
     4324401
SSDB
Motif
Pfam: PRK SRP54 MeaB
Other DBs
NCBI-GeneID: 4324401
NCBI-ProteinID: XP_015622243
UniProt: Q5QLG3 B9EYM4
LinkDB
Position
1:join(28714714..28714870,28715414..28715772,28716126..28716205,28716288..28716339,28716433..28716474,28716562..28716640,28716803..28716834,28716914..28716982,28717069..28717143,28717224..28717340,28717429..28717479,28717987..28718130)
AA seq 418 aa
MTPLHAAPHHAAAAAAVVSSPSSAPLLLRAKPYHPKAAACSFTVTATTPSRKAFLSCPDH
GQAAAGAAPPRSAPASSPALISSVQDLYDFICSGPLVDRIGYTKEKIAGSIDRWLRCGVQ
VARLFRLNELHLSEAEKARIYHFYIPVFLWCEDQVTEHRAKYKDGDEIPPLVIGVSAPQG
SGKTTLVFALDYLFRVAGRNAATLSIDDFYLTAAEQGKLRERNPGNALLELRGNAGSHDL
PFSVETLESLLKLTKEGLKMKLPRYDKSAFGGRGDRADPSTWPEVEGPLEVVLFEGWMLG
FKPLPNEVVKAVDPQLEVVNKNLEAYYDAWDRFIGSWMVIKIKEPSCVYQWRLQAEIAMR
ADGKPGMSDEEVMDFVSRYLPAYHAYLPTLYKEGPNGSNPDHLLVVDIDEKRNPMWGR
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgacgccgctccacgccgccccgcaccatgccgcggccgcggccgcggtcgtctcctcg
ccctcatccgcgccgctcctcctccgcgccaagccttaccaccccaaggcggcggcttgc
tccttcaccgtgaccgccaccactccgtcgaggaaagctttcctgtcgtgcccggatcac
ggccaggcggcggcgggggcggcgccgccgcgctccgccccggcgtcgtcgccggcgctc
atctcctccgtccaggacctgtacgacttcatctgcagcggcccgctcgtggacaggatc
gggtacaccaaggagaagatcgccggctccatcgaccggtggctgcgctgcggtgtgcag
gtggcccggctgttccgcctcaacgagctccacctctcggaggcggagaaggccaggata
taccacttctacatccccgtcttcctctggtgcgaggaccaggtcacggagcacagggcc
aagtacaaggacggcgacgagatccctccattagtgattggggtcagcgctccccaaggc
agtggaaagacaactcttgttttcgcacttgattatctttttcgggttgctggtaggaat
gccgctacattatctatcgatgacttctacttgacggcagcagaacagggtaaattgagg
gaaagaaatcctggaaatgctcttttggagcttcgtggaaatgctggaagccatgatctc
ccgttctcagttgaaacacttgaatcgctgcttaaactaactaaagaaggtttgaagatg
aagcttccacggtatgacaagtctgcttttggtggaagaggtgatcgggctgatccttca
acatggccagaggttgaagggcccttagaggttgttctttttgaaggatggatgcttgga
ttcaaacctcttccaaatgaagttgtaaaagcagtggaccctcagcttgaggtggttaat
aagaaccttgaggcatactacgatgcatgggacaggttcattgggtcatggatggtcata
aaaataaaggaacctagttgcgtgtaccagtggagactgcaggcagagatagctatgaga
gcagatgggaaaccaggaatgtctgatgaggaggtcatggattttgtgtcgcgctaccta
ccagcataccacgcatatttgcccactctatataaagagggaccaaacggctcgaaccca
gaccacctgctggtcgttgacatagacgaaaagaggaatcctatgtggggtagatga

DBGET integrated database retrieval system