KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324442
Entry
4324442           CDS       T01015                                 
Name
(RefSeq) isocitrate dehydrogenase [NAD] catalytic subunit 5, mitochondrial
  KO
K00030  isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4324442
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.41  isocitrate dehydrogenase (NAD+)
     4324442
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 4324442
NCBI-ProteinID: XP_015611169
UniProt: A0A8J8Y8S3 Q9SDG5
LinkDB
Position
1:9665366..9670197
AA seq 362 aa
MALRRLLQGSVLPRMAGRAAAAPFSTASGETVRATLFPGDGIGPEIAESVKQVFNVAGVP
IEWEEHYVGTEVDPRTESFLTWESLESVRRNKVGLKGPMATPIGKGHRSLNLTLRKELGL
YANVRPCNSLPGYKTRYDDVNLVTIRENTEGEYSGLEHQVVRGVVESLKIITRQASLRVA
EYAFHYAKTNGRERVSAIHKANIMRKTDGLFLKCCREVAEKYPEIVYEEVIIDNCCMTLV
KNPGLFDVLVMPNLYGDIISDLCAGLIGGLGLTPSCNIGEGGICLAEAVHGSAPDIAGKN
LANPTALMLSAVMMLRHLQFNNQADRIHNAILQTISEGKFRTADLGGKASTSDFTKAVCD
HI
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggcgctacggaggctgctccaggggagcgtcctgccgcggatggcgggcagagccgcc
gcggcgccgttctcgacggcgtccggggagaccgtccgcgccacgctcttcccaggcgac
ggcatcgggccggagatcgccgagtcggtcaagcaggtattcaatgttgcaggggtacca
atagaatgggaagaacactatgttggtacagaagttgatcccagaacagagagttttctg
acttgggaaagcttggagtcggtgcggagaaacaaagttggcttgaaaggtcctatggct
acgcctattggaaaaggccaccgttcattgaatcttacactaaggaaagagcttggtctt
tatgcaaatgttagaccttgcaacagcctcccaggatacaagactcgatatgatgatgtg
aaccttgtgactattcgtgaaaataccgagggagaatatagtggccttgagcatcaggtt
gtgaggggtgttgtggaaagcttaaaaattatcactcgccaagcaagtttaagagtggca
gagtatgctttccactatgccaagaccaatggccgggagagggtctctgcgatacacaag
gccaatatcatgaggaagaccgatggtcttttcctcaagtgctgtcgtgaagtggctgag
aagtaccctgaaattgtatacgaggaggtcatcattgacaattgttgtatgacgcttgtg
aagaatcctggtctttttgatgtactggtgatgccaaatctttatggtgatattattagt
gatctttgtgctggtctgattggaggcttgggcttgacacccagctgcaacattggtgaa
ggtggcatttgtctggcagaagctgttcacggttctgctcctgatattgctggcaagaac
cttgcaaacccgaccgctcttatgctgagtgctgttatgatgttgcgccacttgcaattc
aataaccaagcagaccggatccacaacgccatcctccagaccatctccgaggggaaattc
aggactgctgatctcggcggaaaggcgtcgacttcagacttcacgaaggcagtctgtgat
catatctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329858
Entry
4329858           CDS       T01015                                 
Name
(RefSeq) isocitrate dehydrogenase [NAD] regulatory subunit 1, mitochondrial isoform X1
  KO
K00030  isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4329858
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.41  isocitrate dehydrogenase (NAD+)
     4329858
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 4329858
NCBI-ProteinID: XP_015622761
UniProt: Q6ZI55 Q0DZW0
LinkDB
Position
2:complement(23107007..23110384)
AA seq 378 aa
MARRSAPLLQRLLSPTPSPSPSPPHPLAAAAVSRRTVTYMPRPGDGAPRAVTLIPGDGIG
PLVTGAVRQVMEAMHAPVYFESYEVRGDMPTVPPEVIDSIRRNKVCLKGGLATPVGGGVS
SLNVQLRKELDLYASLVNCFNLPGLPTRHDNVDIVVIRENTEGEYSGLEHEVVPGVVESL
KVITKFCSERIAKYAFEYAYLNNRKKVTAVHKANIMKLADGLFLESCREVATKYPGIQYN
EIIVDNCCMQLVAKPEQFDVMVTPNLYGNLVANTAAGIAGGTGVMPGGNVGQDHAVFEQG
ASAGNVGNVKVVEQKKANPVALLLSSAMMLRHLQFPSFADRLETAVKRVIAEGKYRTKDL
GGSSTTQEVTDAVIAHLD
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggcgcggcgatccgcccctctcctccagcgcctcctctcccccactccctccccctcc
ccctccccgccccatcctctcgccgccgccgccgtctcccgccgcaccgtcacctacatg
ccgcggccgggggacggcgccccgcgcgccgtcacgctcatcccgggcgacggcatcggg
cccctcgtcaccggcgccgtgcggcaggtgatggaggccatgcacgcgccggtctacttc
gagtcctacgaggtccgcggcgacatgccgacggttccccccgaggtcatcgactccatc
cgccgcaacaaggtctgcctcaagggcggcctcgccaccccagtcggcgggggtgtctcc
tccctcaacgtgcagctccgcaaggagctcgacctctacgcctccctcgtcaactgcttc
aacctcccggggctgcccaccaggcacgacaacgtcgacattgtcgtcatcagggagaac
accgagggcgagtactccgggcttgagcacgaggtcgtccctggcgtcgtggagagcctt
aaggtgatcacaaagttctgctctgaaaggattgccaagtatgcttttgagtacgcgtac
ctcaacaacagaaagaaagtgactgccgtgcataaagcaaacatcatgaagcttgctgat
ggtttattcttggagtcttgccgtgaggttgcaacaaagtatcctggaattcaatataat
gaaatcatcgtggacaactgttgtatgcagcttgttgctaagcctgaacaatttgatgtt
atggtcacgccaaatctttatggcaatctggtggctaacacggctgcaggtattgctgga
ggcactggtgtcatgcctggaggtaatgtgggtcaggaccatgctgtcttcgagcaagga
gcttctgcaggaaatgttggaaacgtcaaagttgtggagcagaagaaagctaaccccgtt
gctctgctcctctcatctgccatgatgttgcggcatttgcaattcccatcattcgctgac
cggctggagacggcggtgaagcgtgtcatcgcagaaggcaagtacagaaccaaagacttg
ggcggcagcagcaccacgcaggaagtcacggatgcagtgatcgcgcatcttgattaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4336169
Entry
4336169           CDS       T01015                                 
Name
(RefSeq) isocitrate dehydrogenase [NAD] regulatory subunit 1, mitochondrial
  KO
K00030  isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00020  Citrate cycle (TCA cycle)
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01210  2-Oxocarboxylic acid metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
osa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    4336169
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.41  isocitrate dehydrogenase (NAD+)
     4336169
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 4336169
NCBI-ProteinID: XP_015636170
UniProt: Q33E21 A0A8J8XLC9
LinkDB
Position
4:complement(23964013..23967804)
AA seq 373 aa
MARRSAPLLRRILSSPAPAPAHHGGAGARRTVTYMPRPGDGNPRAVTLIPGDGIGPLVTG
AVQQVMEVMHAPVYFETYEVRGDMPTVPPAVIESIRRNKVCLKGGLATPVGGGVSSLNMQ
LRKELDLYASLVNCSNFPGLPTRHQDVDIVVIRENTEGEYSGLEHEVVPGVVESLKVITK
FCSERIAKYAFEYAYLNNRKKVTAVHKANIMKLADGLFLESCREVASKYPGIQYNEIIVD
NCCMQLVAKPEQFDVMVTPNLYGNLVANTAAGIAGGTGVMPGGNVGQDHAVFEQGASAGN
VGNENILEQKKANPIALLLSSAMMLRHLQFPSFADRLETAVKRVIAEGKYRTKDLGGTST
TQEVTDAVIANLD
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggcgcggcgatccgcccccctcctccgccgcatcctctcctccccggcccccgccccg
gcgcaccatggcggcgccggcgcgcgccgcacggtgacctacatgcccaggccaggggac
gggaacccgcgcgccgtgacgctgatcccgggggacgggatcgggccgctcgtgacgggg
gccgtgcagcaggtgatggaggtgatgcacgcgccggtctacttcgagacctacgaggtc
cgcggcgacatgcccaccgtgccgcccgccgtcatcgagtccatccgccgcaacaaggtg
tgcctcaagggcggcctcgccacccccgtcggcggcggggtctcctccctcaacatgcag
ctccgcaaggagctcgacctctacgcctcgctcgtcaactgctccaacttccccggcctc
cccaccaggcaccaggacgtcgacatcgtcgtcatcagggagaacaccgagggggagtac
tcggggctcgagcacgaggtcgtgcccggcgtcgtcgagagcctcaaggtgataacaaag
ttttgctctgagaggattgccaaatatgcttttgagtatgcttaccttaacaaccgaaag
aaagtcacagcagtgcataaagcaaacatcatgaagcttgctgatggtttgttcttggaa
tcttgccgtgaggttgcctcaaagtatcctggtattcagtataatgagatcattgtcgac
aactgctgtatgcaacttgttgcaaagcctgagcaatttgatgtcatggttacaccaaac
ctttatggcaatttggttgctaacacggctgcaggtattgctggagggacaggtgttatg
cctggaggtaatgtgggtcaggaccatgctgtctttgagcaaggtgcttctgcaggaaac
gtcggaaacgagaacatcttagagcagaagaaagcaaaccctattgcgctgcttctatca
tccgccatgatgttgaggcatttgcagttcccgtcattcgccgaccggctggagacggcg
gtgaagcgtgtcattgcggaaggcaagtacagaacaaaggatctaggcggcaccagcacc
acccaggaagtcactgatgcagtaatcgccaatctggattag

DBGET integrated database retrieval system