KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324465
Entry
4324465           CDS       T01015                                 
Name
(RefSeq) uridylate kinase
  KO
K09903  uridylate kinase [EC:2.7.4.22]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00240  Pyrimidine metabolism
osa01100  Metabolic pathways
osa01232  Nucleotide metabolism
osa01240  Biosynthesis of cofactors
Module
osa_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    4324465
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.22  UMP kinase
     4324465
SSDB
Motif
Pfam: AA_kinase
Other DBs
NCBI-GeneID: 4324465
NCBI-ProteinID: XP_015638950
UniProt: Q5JJV9 A0A8J8XDX3
LinkDB
Position
1:42562810..42566963
AA seq 351 aa
MAAAAAAAVACGMSTSFLIRLSPSPPASSHVPLPRSPASSARPRRASSVSLSTAPRPRAR
AAGSDSPSNFGGQTSLMPPFSLMLDEGSRSKKPYRWQRVLLKVSGEALAGDHTENIDPKI
TMAIAREVASVTRLGVEVAIVVGGGNIFRGASWAGCSGLDRSSADYIGMLATVMNAIFLQ
ATMESIGIPTRVQTAFRMSEVAEPYIRRRAVRHLEKGRVVIFAAGTGNPFFTTDTAAALR
CAEINAEVVLKATNVDGVYDADPKRNPNARLLEAVSYHEVQTRDLSVMDMTAITLCQENN
IPVVVFNLQKPGNIAKAIVGEKVGTFIGCTKDQDQIVGNALDQERRLVNEL
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggccgccgccgccgccgccgccgtcgcctgcggcatgtctacgtccttcctcatccgc
ctctcgccttcgccgccggcgtcttcccacgtgcctctccctcggtctccggcttcgtcg
gcgcgcccgcggcgagcgtcttccgtctccctctccaccgcgcctaggccgagggcacgc
gccgccggctccgactctccctccaactttggaggtcaaacatcactgatgccaccattc
agccttatgcttgatgaaggctctagatctaaaaagccatatagatggcaaagggtgttg
cttaaagtaagtggggaggctcttgctggagatcacacagaaaatattgatccaaagatc
acgatggcaattgcaagagaggttgcttctgtcaccagactaggtgtagaggttgctatt
gttgttggtggcggcaatatcttccgcggggcctcttgggctggatgtagtggactcgac
cgctcatcagcagattacattggcatgttggctactgtgatgaatgccatatttcttcaa
gcaacaatggagagcattggaataccaacccgtgtccaaactgcatttcgtatgtcagaa
gttgcagaaccatacatacgccgaagagctgtcaggcatttagagaaaggaagagttgtt
atatttgctgctggtacagggaacccattctttacaactgatacagctgctgctcttcgt
tgtgcagaaatcaatgcagaggtagtacttaaggcaacaaatgttgacggtgtgtacgac
gcagaccccaagcgtaacccaaatgcccgccttcttgaggctgtgagctaccatgaggtg
caaacaagagacctctcagtaatggacatgactgccattacgctatgccaagaaaacaac
attcctgttgtcgtgtttaatttgcaaaaacctggaaatattgcgaaagctattgttggt
gagaaggttggcacgtttataggctgcacaaaagatcaggaccagattgtggggaatgca
ctggatcaagaaagaagattggtgaacgagttatga

DBGET integrated database retrieval system