KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324491
Entry
4324491           CDS       T01015                                 
Name
(RefSeq) 2-hydroxyacyl-CoA lyase
  KO
K12261  2-hydroxyacyl-CoA lyase [EC:4.1.2.63]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4324491
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.63  2-hydroxyacyl-CoA lyase
     4324491
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C CO_dh
Other DBs
NCBI-GeneID: 4324491
NCBI-ProteinID: XP_015616825
UniProt: Q0JMH0
LinkDB
Position
1:17560749..17564941
AA seq 577 aa
MATDTAAPAAMKVDGSALAGRALAAAGARHMFGVVGIPVTSLASRAAAAGVRFLAFRNEQ
SAGYAAAAYGFLTGSPGLLLTVSGPGCVHGLAGLSHATANAWPLLMVSGSCSQPDAGRGD
FQELDQIAATKPFIKIAVKATTIADIPRLVFQALAATVSGRPGGCYLDIPSDVLHQTLTE
SEAAALIDAAAADSAKSDSSPPKHKSLDEGIEKAAELLRRAERPLVVFGKGAAYSRAEDA
IWKLVDTTGIPFLPTPMGKGVVPDTHPLSATAARSLAIGQCDVALVVGARLNWLLHFGEP
PKWSKDVKFILVDVCEEEIELRKPHVGIVGDAKRVVELINREIKDQPFCLAPSHPWVEAI
TKKARDNVLKMEAQLAKDVVPFNFLTPLRIIRDAILAEGNPAPVVVSEGANTMDVGRAVL
VQNEPRTRLDAGTWGTMGVGLGFCVAAAVAEPDRLVVAVEGDSGFGFSAMEVETLVRYQL
PVVVIVFNNNGVYGGDRRSPDEITGPYKDDPAPTSFVPAAGYHKMMEAFGGKGYLVETPD
ELKSALSESFRARKPAVINVIIDPYAGAESGRMQHKN
NT seq 1734 nt   +upstreamnt  +downstreamnt
atggcgaccgacaccgccgctccagctgccatgaaggtcgacggcagcgccctcgccggg
cgcgcgctggccgcggccggggcgcggcacatgttcggggtggtgggcatcccggtcacc
tccctcgcgtcccgcgccgcggccgccggtgtccgcttcctcgccttccgcaacgagcag
tccgcgggctacgccgccgccgcctacggcttcctcaccggctcccccggcctgctcctc
accgtctccggccccggctgcgtccacggcctcgcgggcctctcccacgccaccgccaac
gcctggccgctcctcatggtctccggctcctgctcccagccagacgccggcaggggcgac
ttccaggagctcgaccagatcgccgccaccaagcctttcatcaagatcgccgtcaaggca
accaccatcgccgacatccctcgcctcgtcttccaggccctcgccgccaccgtctccggc
cgccccggcggctgctacctcgacatcccatccgacgtcctccaccaaaccctcacggaa
tcggaggccgccgccctcatcgacgctgccgccgccgattcggccaaatccgattcttct
ccacccaagcacaagtccctggacgagggaatcgagaaggcggcggagctgctccgccgc
gcggagcggcctctggttgtgtttgggaagggcgcggcgtattctcgcgctgaggacgcc
atctggaagctggtggataccacgggcatccccttcctcccgacgccgatgggaaagggt
gttgtgcccgacacgcacccactgtcggccaccgcggcgcgctctctcgccattgggcaa
tgtgatgtggcattagtcgttggtgctcggcttaattggttgcttcacttcggtgagcca
cccaaatggtccaaagatgtgaaattcatacttgtggatgtctgcgaggaggagattgag
ctccggaagccgcatgttggaattgttggggatgccaagagagttgtggagcttatcaat
agggagatcaaggaccagccattctgcttggcaccatcacacccatgggttgaagcaatc
accaagaaggccagggacaatgttcttaagatggaggctcagcttgccaaggatgttgtg
ccattcaatttcctgacacctttgcggattatccgggatgctatacttgctgagggaaac
cctgctcctgtagtggtctcagaaggggcaaacaccatggatgtcggcagggcagtgctt
gtgcagaacgagccgaggactagactggatgcaggtacatgggggacaatgggagttgga
ttgggattctgtgttgcagctgcagttgctgagcctgatcgacttgtggttgctgtggag
ggtgattctggatttggattcagtgcaatggaggttgagacattggtaaggtaccagctg
cctgttgttgtaattgtcttcaacaataatggagtttatggcggtgatcggagaagccct
gatgagataaccggaccgtacaaagatgatcctgccccaacctctttcgttccagctgct
ggttaccataaaatgatggaagcttttggaggaaaaggttatcttgttgagacaccagat
gagctaaaatccgccctttcagagtcgtttcgtgccaggaagccagcggtgataaatgtt
atcattgatccttatgctggtgcagagagcggtagaatgcagcataagaactga

DBGET integrated database retrieval system