KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324662
Entry
4324662           CDS       T01015                                 
Name
(RefSeq) probable acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase, mitochondrial isoform X1
  KO
K00677  UDP-N-acetylglucosamine acyltransferase [EC:2.3.1.129]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:osa01005]
    4324662
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.129  acyl-[acyl-carrier-protein]---UDP-N-acetylglucosamine O-acyltransferase
     4324662
Lipopolysaccharide biosynthesis proteins [BR:osa01005]
 Lipid A
  4324662
SSDB
Motif
Pfam: Hexapep Acetyltransf_11 Dsc3_C COS
Other DBs
NCBI-GeneID: 4324662
NCBI-ProteinID: XP_015622394
UniProt: Q5JMA6 Q0JJR5
LinkDB
Position
1:30102790..30107385
AA seq 327 aa
MAAAATRAVRRLLIASRSLHAISSEGAAREAATSFVHPAAVVHPDAVVGQGVSIGPFCTV
GASARIGDACQLHAGSHVMGDTELGERCVVLTGAILGSDIPGQTIIGENNVIGHHAVVGV
KCQDLKYKSGDECFLQIGNNNEIREYCSIHRSSKSCDCTVIGDNNLIMGSCHIAHDCRIG
NNNIFANNTLFAGHVVVEDCTHTAGAVVVHQFCHIGSFSFLGGGSVIAQDVPRYMMVAGD
RAELRGLNLEGLKRNGFSDQEVRMLRKAYQQVFMPSINSQSSFDERLAELEREIELSETH
VSYMVESIRMSFGQGRRGICKFRSWNR
NT seq 984 nt   +upstreamnt  +downstreamnt
atggccgccgccgccacccgcgccgtccgccgcctcctcatcgcctcgcggagtctccac
gcaatctcttccgagggagcggcgagggaggcggccacgagcttcgtccaccccgccgcc
gtcgtccaccccgacgccgtcgtcggacagggtgtctcgataggcccattttgcaccgtg
ggagcttcagcgaggattggtgacgcttgtcagttacacgctgggagccatgtcatggga
gataccgagctaggggagagatgtgttgttctcactggcgctatccttggttcagacatt
cctgggcaaaccattatcggtgaaaacaatgtcattggacaccacgctgtagttggtgtt
aagtgccaagatctcaagtataagtcaggagatgaatgctttctacagattggtaacaat
aatgagatcagagagtactgttctattcatcgctcttctaaatcttgtgactgcacggtt
attggtgacaataatcttataatgggttcatgccatatagcacatgattgcaggattggc
aacaataacatatttgctaacaatactctatttgctggccatgttgttgttgaagattgc
acccatactgcaggggctgttgttgtccatcaattttgtcatattgggtcattttcattt
ctaggtggaggctctgtgatcgcacaagatgtgccaagatacatgatggttgcaggtgat
agagcagagcttcgtgggctgaatcttgaaggtcttaagcgcaatggtttctcagaccaa
gaggtacggatgttgaggaaagcttatcaacaagtatttatgccatctattaatagtcag
agtagctttgatgagagacttgctgaactggaacgggaaattgagttatcagaaactcat
gtatcctatatggtggaatctattcgcatgtcctttggccaaggacgtcgtggaatttgc
aaatttagaagttggaaccgctga

DBGET integrated database retrieval system