KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324671
Entry
4324671           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S24-1
  KO
K02974  small subunit ribosomal protein S24e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4324671
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4324671
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4324671
  Archaea
    4324671
SSDB
Motif
Pfam: Ribosomal_S24e C9orf72-like
Other DBs
NCBI-GeneID: 4324671
NCBI-ProteinID: XP_015614819
UniProt: A0A0N7KDN4 Q8W0C2
LinkDB
Position
1:complement(30157963..30159797)
AA seq 138 aa
MSDSKAAAAVTLRTRKFMTNRLLSRKQFVLEVIHPGRPNVSKAELKEKLAKLYEVKDANC
IFVFKFRTHFGGGKSTGFGLIYDNLDAAKKYEPKYRLIRNGLATKVEKSRKQMKERKNRA
KKIRGVKKTKAGDAGKKK
NT seq 417 nt   +upstreamnt  +downstreamnt
atgtcggactccaaggccgcggcggcggtcaccctccgcacccgcaagttcatgaccaac
cgcctcctctcccgcaagcaattcgtgctcgaggtgatccaccccggccggcccaacgtc
tccaaggctgagctgaaggagaagctggccaagctgtacgaggtgaaggacgcgaactgc
atcttcgtgttcaagttccgcacccacttcggtggaggcaagtccaccggattcggcctc
atctacgataacctcgacgccgcgaagaagtacgagcccaagtaccgcctcatcaggaat
ggtcttgctaccaaggttgagaaatctcgcaagcaaatgaaagaacgcaagaacagagct
aagaagatccgtggtgtcaagaagaccaaggctggtgatgccgggaaaaagaagtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4328797
Entry
4328797           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S24-1
  KO
K02974  small subunit ribosomal protein S24e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4328797
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4328797
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4328797
  Archaea
    4328797
SSDB
Motif
Pfam: Ribosomal_S24e C9orf72-like
Other DBs
NCBI-GeneID: 4328797
NCBI-ProteinID: XP_015623021
UniProt: Q6H5X7 Q6H541
LinkDB
Position
2:complement(7258645..7260391)
AA seq 138 aa
MADTKTAPAVTLRTRKFMTNRLLSRKQFVLEVLHPGRANVSKADLKEKLAKLYEVKDSNC
IFVFKFRTHFGGGKSTGFGLIYDNLDAAKKYEPKYRLIRNGLATKVEKSRKQMKERKNRA
KKIRGVKKTKAGDAGKKK
NT seq 417 nt   +upstreamnt  +downstreamnt
atggccgacacgaagacggcgccggcggtgacgctccgcacccgcaagttcatgacgaac
cgcctcctctcccgcaagcagttcgtgctcgaggtgctccacccgggccgcgccaacgtc
tccaaggcggatctgaaggagaagctggcgaagctgtacgaggtgaaggactccaactgc
atcttcgtgttcaagttccgcacccacttcggaggaggcaagtccaccggattcggactc
atctacgacaacctcgacgccgccaagaagtacgagcccaagtacaggctcatcaggaat
ggcctcgccaccaaggttgagaagtctcgcaagcagatgaaggagaggaagaacagagca
aagaagatccgtggtgtgaagaagacaaaggctggagatgcaggcaagaagaagtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4341282
Entry
4341282           CDS       T01015                                 
Name
(RefSeq) 40S ribosomal protein S24-1
  KO
K02974  small subunit ribosomal protein S24e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4341282
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4341282
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    4341282
  Archaea
    4341282
SSDB
Motif
Pfam: Ribosomal_S24e C9orf72-like
Other DBs
NCBI-GeneID: 4341282
NCBI-ProteinID: XP_015643695
UniProt: Q5Z9S4
LinkDB
Position
6:21163223..21167157
AA seq 138 aa
MSESKAAAAVTLRTRKFMTNRLLSRKQFVLEVLHPGRANVSKADLKEKLAKLYEVKDSNC
IFVFKFRTHFGGGKSTGFGLIYDNLDAAKKYEPKYRLIRNGLATKVEKSRKQMKERKNRA
KKIRGVKKTKAGDAGKKK
NT seq 417 nt   +upstreamnt  +downstreamnt
atgtcggaatcgaaggccgccgcggcggtgaccctccgcacccgcaagttcatgacgaac
cgcctcctctcccgcaagcagttcgtgctcgaggtgctccacccgggccgcgccaacgtc
tccaaggcggatctgaaggagaagctggcgaagctgtacgaggtgaaggactccaactgc
atcttcgtgttcaagttccgcacccacttcggaggcggcaagtccaccggattcggcctc
atctacgacaacctcgacgccgccaagaagtacgagcccaagtacaggctcatcaggaat
ggtcttgccactaaggtagagaagtcacgtaagcagatgaaggaacggaagaacagagca
aagaagatccgtggtgtgaagaagacaaaggctggagatgctgggaagaagaagtga

DBGET integrated database retrieval system