KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324672
Entry
4324672           CDS       T01015                                 
Name
(RefSeq) NADP-specific glutamate dehydrogenase isoform X1
  KO
K00262  glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00220  Arginine biosynthesis
osa00250  Alanine, aspartate and glutamate metabolism
osa00910  Nitrogen metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    4324672
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4324672
   00220 Arginine biosynthesis
    4324672
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.4  glutamate dehydrogenase (NADP+)
     4324672
SSDB
Motif
Pfam: ELFV_dehydrog ELFV_dehydrog_N NAD_binding_7
Other DBs
NCBI-GeneID: 4324672
NCBI-ProteinID: XP_015619494
LinkDB
Position
1:21118886..21124713
AA seq 656 aa
MDELNLLRQHQHQHQHHLVVRGLGEEIDLEIGPGDDPSFPGAALVGVTPGAHDPADDHKS
LLIPCSQPVAEGQPQPTPPQVEEHDGLLRLPGQTKKKKKVVKKWREEWADTYKWAYVAVH
DNTSRIFCTVCKEYGRKHRRNPYGNEGSRNMQMSALEEHNNSLLHKEALRLQTASKENAQ
PPEIERPVYVKALSKTAASILESILKKDPHEAEFIQSIQEVVHSLEPVLVKNSQHVQILE
RLLEPERCFIFRVPWVDDRGEAHVNRGFRVQFSQALGPCRGGLRFHPSMTLSVAKFLAFE
QTLKNALSQYKLGGAAGGSDFDPKGKSESEIMRFCQSFMDELYRYLGPDQDFPAEDVGVG
PREMGYLFGQYRRLSGHFQGNFTGPKIFWSGSSFRTEATGYGLVFFARVVLADMNKELKG
LRCVISGSGKIAMHVLEKLLSCEAIPVTVSDSKGYLLDTEGFDYMKYSVLRNIKAQQRSL
KEYLKSYPNAKYIDDAKPWSEKCDVAFPCASQNEIDQAEALAIINSGCRVLIECSNMPCT
AQAVDILRTAKVVVAPAKATAAGGVAVGELELNPEFSLMQWSVEDFENKIQDAVKQTYDR
SIKAAQDYGIMKENPELVFFLCSEDVFLCFRLVSTQKLIDLSMQVVGAWCKHMCVS
NT seq 1971 nt   +upstreamnt  +downstreamnt
atggacgagctcaacctattgcggcagcaccagcaccagcaccagcaccacctggtggtg
cgcggcctcggcgaggagatcgacctcgagatcggcccgggcgacgacccctccttcccc
ggcgcggccctcgtcggcgtcacccccggcgcgcacgaccccgcggacgaccacaagagc
ctcctcatcccgtgctcgcagcccgtcgccgaggggcagccgcagccgacgccgccgcag
gtggaggagcacgacgggctgctacggctgccggggcaaaccaagaagaagaagaaggtg
gtgaagaaatggagggaggagtgggcggacacctacaagtgggcctacgtcgccgtgcac
gacaacaccagcaggatcttctgcaccgtgtgcaaggagtacgggcggaagcaccgccgg
aatccctacgggaacgaggggagcaggaacatgcagatgagcgcgctggaggagcacaac
aacagcttgctgcacaaggaggcgctgcggttgcagacggcgtccaaggagaacgcgcag
ccccctgagatcgagaggccggtatatgtcaaagctctgtcgaaaactgcagcctctata
cttgaatctatcctaaagaaggaccctcatgaagctgagtttatacagtctatccaagag
gtggttcattccttggaaccagttttggtgaagaactcccaacatgtccaaattttggag
cgtttgttggaacctgagagatgctttatcttcagagtgccatgggttgatgatagaggt
gaagcacatgtaaatcgaggcttccgtgtgcagttcagtcaagcgttaggtccatgcaga
ggtggtcttcgtttccacccttccatgactttgagcgtagcaaaatttctagcttttgag
cagactctaaaaaatgctttgtcacaatataaacttggaggagctgctggagggagtgat
tttgatcccaagggtaaaagtgaaagtgagataatgcgtttttgtcaaagtttcatggat
gagctgtatagatatttggggcctgatcaggattttcctgctgaagatgttggtgtgggt
ccaagagaaatgggttatctttttgggcagtatagacgcctttctggtcattttcagggg
aattttacagggcctaaaatcttctggtctggttctagtttccgaacagaagctactgga
tacggactggtattctttgcacgtgtagtgcttgctgatatgaacaaggaactcaaagga
ttaagatgtgtgataagtggttctggaaagatagcaatgcatgtattggaaaagcttctg
tcatgtgaagctattcctgttacagtttcagattcgaagggttatttgttagacacggaa
gggtttgattacatgaaatattcagttctaaggaacatcaaggctcagcaaaggagcctc
aaggaatacttgaaatcatatccaaatgccaaatatatagatgatgcaaagccctggagt
gagaagtgtgacgttgcattcccttgtgcatcacaaaatgagattgaccaggcggaggct
cttgcaataattaactctggctgccgtgttcttatagaatgttcaaatatgccttgcact
gctcaagcagttgatatcctacgaacagcaaaagtagttgttgctcccgcaaaggcaact
gccgctggtggggtagcagttggagaactcgaactgaaccctgagttcagtttgatgcag
tggtcagtggaggattttgagaacaaaatacaggatgcggtgaaacaaacatatgacaga
tctatcaaagctgctcaagattatggaatcatgaaagagaacccagagttagttttcttc
ttgtgctctgaggatgtcttcctttgtttccgcctggtttcaacccagaagctgatcgat
ctctctatgcaggtcgttggtgcatggtgcaaacatatgtgcgtttcttaa

DBGET integrated database retrieval system