KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324704
Entry
4324704           CDS       T01015                                 
Name
(RefSeq) inorganic pyrophosphatase 1
  KO
K06124  phosphoethanolamine/phosphocholine phosphatase [EC:3.1.3.75]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00564  Glycerophospholipid metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    4324704
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4324704
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.75  phosphoethanolamine/phosphocholine phosphatase
     4324704
Protein phosphatases and associated proteins [BR:osa01009]
 HAD phosphatases
  Other HAD phosphatases
   4324704
SSDB
Motif
Pfam: Put_Phosphatase HAD
Other DBs
NCBI-GeneID: 4324704
NCBI-ProteinID: XP_015648259
UniProt: A0A0N7KDN0 Q8W0E7
LinkDB
Position
1:complement(30025354..30026483)
AA seq 274 aa
MAGIVVVFDFDKTIIDVDSDNWVVDGLGATEEFERLLPTMPWNTLMDTMMGELHASGKSL
ADVAGVLRSAPLDPRVVAAIKACYGLGCDLRILSDANRFFIDTILDHHGLTGYFSEINTN
PSAVDAATGRLRIAPYHDFHAGPHGCGLGICPPNMCKGQVLDRIRASAGAAGKRVIYLGD
GRGDYCPSLRLGRDDFMMPRRGFPVWELICEDPSLLHAEVHSWADGAEMEETLLRLVGRV
LLEERNLPPLDCKLESLPAVAVQDGMPMTLRIKN
NT seq 825 nt   +upstreamnt  +downstreamnt
atggccgggatcgtggtggtgttcgacttcgacaagacgatcatcgacgtcgacagcgac
aactgggtcgtggacgggctcggcgcgacggaggagttcgagcggctgctgcccaccatg
ccgtggaacaccctcatggacaccatgatgggcgagctccacgcgagcggcaagtcgctc
gccgacgtcgcgggcgtgctcaggtcggcgccgctcgacccgcgcgtcgtcgccgccatc
aaggcctgctacggcctgggctgcgacctccggatcctcagcgacgccaaccgcttcttc
atcgacaccatcctcgaccaccacggcctcacgggttacttctccgagatcaacaccaac
ccgagcgccgtcgacgccgccaccggccgcctccgcatcgcgccgtaccacgacttccac
gccggcccgcacgggtgcggcctcgggatctgcccgcccaacatgtgcaagggccaggtg
ctcgaccgcatccgcgcctccgccggcgccgccggcaagagggtcatctacctcggtgac
ggccgcggcgactactgcccgtcgctccgcctcggccgcgacgacttcatgatgccacgc
aggggcttccccgtgtgggagctcatctgcgaggacccgtcgctgctccacgcggaggtg
cactcgtgggccgacggcgccgagatggaggagacgctgctgcggctggtcggcagggtg
ctcctcgaggagaggaacctgccgccgctcgactgcaagctcgagtcgttgccggccgtc
gccgtgcaggacggcatgcccatgacgctccggatcaagaactga

DBGET integrated database retrieval system