KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324717
Entry
4324717           CDS       T01015                                 
Name
(RefSeq) NADP-dependent malic enzyme isoform X1
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00620  Pyruvate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Module
osa_M00169  CAM (Crassulacean acid metabolism), light
osa_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4324717
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4324717
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     4324717
SSDB
Motif
Pfam: Malic_M malic
Other DBs
NCBI-GeneID: 4324717
NCBI-ProteinID: XP_015620425
LinkDB
Position
1:30166022..30171653
AA seq 642 aa
MRALRSRFLPLLARRWQWQWQWQWEFQGRRAARCGLCGEAREEEEEEGKMESTMKGIRGD
NAPCVLDLDDAATVGGGVGDTYGEDCATEEQLVTPWTVSVASGYNLLRDPRYNKGLAFNE
RERETHYLRGLLPPAIVSQELQERKIMHNIRQYQLPLQKYMAMMDLQEGNERLFYKLLID
NVEELLPVVYTPTVGEACQKYGSIFSRPQGLYISLKEKGKILEVLKNWPERSIQVIVVTD
GERILGLGDLGCQGMGIPVGKLALYTALGGVRPSACLPITLDVGTNNEALLNDEFYIGLR
QKRATAQEYADFLHEFMTAVKQNYGEKVLIQFEDFANHNAFELLAKYGTTHLVFNDDIQG
TASVVLSGLVAALKLVGGSLSEHSYLFLGAGEAGTGIAELIALEISRQTKAPIEECRKKI
WLVDSKGLIVSSRKETLQHFKKPWAHEHEPVGNLLDAVKTIKPTVLIGTSGKGQTFTQEV
VEAISSFNERPVIFALSNPTSQSECTAEQAYTWSKGRAVFASGSPFDPVEYDGKIYVPGQ
ANNAYIFPGFGLGVVMSGAIRVHDDMLLAASEALAQQVTQENFDKGLTYPPFSNIRKISA
HIAANVAAKAYELGLASRRPRPKDLVKYAESCMYSPLYRNYR
NT seq 1929 nt   +upstreamnt  +downstreamnt
atgcgcgcccttcgctcccgcttccttccgctactagcacggcggtggcagtggcagtgg
cagtggcagtgggagttccagggacgtagagcagcgcggtgcggattgtgcggggaggcg
cgggaggaggaggaggaggaggggaagatggagagcaccatgaaggggatccgcggggac
aacgcgccgtgcgtgctggacctggacgacgcggcgacggtggggggcggcgtcggggac
acctacggcgaggactgcgccaccgaggagcagctcgtcacgccgtggaccgtctccgtc
gccagtggttacaatttgctgagggatcctcgctacaacaaggggcttgccttcaacgaa
agggagcgcgaaacgcactacctccgtgggcttctgccaccagcaatcgtatcccaggag
ctccaggaaaggaaaatcatgcataacatccgacaataccagctgcctctgcagaaatac
atggctatgatggacctccaggaggggaatgagaggcttttctacaagctcctcattgac
aatgttgaggagctacttcctgtcgtttacactccaacagttggtgaggcctgccaaaag
tatggatccatatttagccgtcctcagggtctttatatcagcttgaaggagaagggaaag
atccttgaggtgctaaaaaactggccagagaggagcattcaggttatcgttgttactgat
ggtgagcgaattttggggcttggagatcttggctgccagggaatggggatccctgttggt
aagcttgccctttacactgctctaggaggagtgcgtccatctgcttgtttgccaatcaca
ttggatgttggtacaaataacgaggcgctgctgaatgatgagttctacattggcttaaga
caaaagagggccactgctcaggagtatgctgattttcttcatgaattcatgactgccgtg
aaacaaaactatggggagaaagtactcattcagtttgaggattttgcaaaccataatgca
tttgaactccttgcaaaatatggaacaactcaccttgtattcaatgatgatattcaggga
acagcttccgtggtcctttctgggcttgttgcagcactaaaattagttggtggttcattg
tcggagcacagttacctgttcctgggagctggagaggctgggacaggcattgcagaactt
atagctctcgagatatcaagacagaccaaagcaccaattgaggagtgccgcaagaaaata
tggcttgttgattcaaagggcttgattgtcagttcacgaaaggagacccttcaacacttc
aagaaaccatgggcccatgagcatgaacctgttggaaatctcttagatgcagtcaaaact
atcaaaccaacagtattgattggcacatctggaaaggggcaaactttcactcaggaggtt
gttgaagccatttcctcatttaatgagaggcctgtcatttttgccttgtccaacccaaca
tctcagtctgagtgcaccgctgaacaagcgtacacatggagcaagggccgcgcggtgttt
gcaagtggaagtccatttgatccggtggagtatgatggcaaaatatacgtgcctggccag
gcaaacaacgcctacatcttcccagggtttggccttggtgtggtgatgtctggtgcaatc
cgtgttcatgatgacatgcttcttgcagcttcggaagcactggctcagcaggtcacacaa
gagaatttcgacaagggccttacttatcctcccttctcaaacatcagaaagatctctgcc
cacattgcagccaacgttgcagcaaaggcatatgaacttggtttggcaagcaggcgccct
cggccaaaggacctggttaagtatgcagagagctgcatgtacagcccactttaccgcaac
taccggtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326552
Entry
4326552           CDS       T01015                                 
Name
(RefSeq) NADP-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00620  Pyruvate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Module
osa_M00169  CAM (Crassulacean acid metabolism), light
osa_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4326552
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4326552
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     4326552
SSDB
Motif
Pfam: Malic_M malic
Other DBs
NCBI-GeneID: 4326552
NCBI-ProteinID: XP_015614053
UniProt: Q5JKW5 A0A0N7KDQ8
LinkDB
Position
1:31076561..31081303
AA seq 585 aa
MAGRGEGNGAATMAGVATGGVEDAYGEDRATEDQPITPWAVCVASGHSLLRDPRHNKGLS
FTEKERDAHYLRGLLPPVVLSQELQEKRLLQNVRQFQVPLQRYMALMDLQERNERLFYKL
LIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYISLKEKGRILELLRNWPEKSIQVIV
VTDGERILGLGDLGCQGMGIPVGKLALYTALGGVRPSACLPITIDVGTNNEDLLKDEFYI
GLRQKRATGQEYSDLLDEFMAAIKQNYGQKVLVQFEDFANYNAFTLLEKYRANNLVFNDD
IQGTAAVVLAGLIAAQKFVSGTLADHTFLFFGAGEAGTGIAELVALEISNQSKVPVEDAR
KKIWLLDSKGLIVSSRKDSLQPFKKRYAHEHEPVKDLLDAVKVIKPTALIGSAGVGQSFT
KEVIEAMSSINERPIILALSNPTSQSECTAEQAYSWSKGRAIFGSGSPFDPVKYNDKLFV
PAQANNAYIFPGFGLGVVISGAIRVKDEMILAAAEGLADQVTPEHVDKGLIYPPFSCIRK
ISANIAARVAAKAYDLGLASHLPRPKDLVKYAESCMYSPIYRSYR
NT seq 1758 nt   +upstreamnt  +downstreamnt
atggcggggcgaggagaggggaacggcgctgcgacgatggcgggggtggccaccggtggc
gtggaggacgcctacggcgaggaccgcgccaccgaggaccagcccatcacgccgtgggcc
gtctgcgtcgccagcggtcactctctgctgagggatccacggcacaacaaggggctatca
ttcacggagaaagagcgagacgcccactacctgcggggtttgctgcctccagtcgtgctc
tcccaagaacttcaggagaagaggcttctgcaaaatgtgcggcagtttcaggttcctctg
caacgttacatggctctgatggaccttcaggagaggaatgagaggcttttctacaagctc
ctgatcgacaacgttgaggaattgctccccgttgtgtacacgccgacggtgggcgaggct
tgccagaagtacgggtcaatctttagacgaccacagggtctgtacatcagtcttaaagag
aaggggagaatattggagttactgaggaactggccagagaagagcattcaggttattgtt
gttactgatggtgagcgcattttaggtctcggggatcttggttgccagggtatgggaatc
cctgtgggaaagcttgcactatacacagcccttggaggtgtccggccttctgcttgctta
cctatcaccattgatgtgggaacaaacaatgaggatttactgaaggacgagttctacatt
ggattaagacaaaaacgagccactggccaggaatatagtgatcttctggatgaattcatg
gctgctattaagcagaactatggacagaaggtgctagtccagtttgaagacttcgcaaat
tacaatgcatttacccttcttgagaagtaccgtgcaaacaatcttgtcttcaatgatgat
attcagggaacggctgctgtagtgcttgcaggcctcattgctgctcagaaatttgtcagt
gggactttagctgatcacacattcttattctttggcgcaggagaggctggtacaggcatt
gctgaactagtggctctcgagatatcaaatcagtccaaagttccagtggaagatgctcgc
aaaaagatctggctacttgattcaaaggggttgattgtcagttcacgtaaagattctctt
cagccctttaagaagcgatatgcccatgagcatgaaccagtcaaagatctactggatgct
gttaaggttatcaaaccgactgcattgataggttcagctggtgtgggtcaaagtttcaca
aaagaggtgattgaggctatgagttcaattaatgagagaccaatcatcctcgcactatcc
aatccaacatcacaatctgaatgtactgctgaacaggcatattcatggagtaagggccgt
gcaatatttgggagtggaagtccatttgatccagttaaatacaatgacaagcttttcgtg
cctgcacaggcaaacaatgcatatatattcccaggatttggcctaggcgtagtgatttca
ggagcgataagggtgaaagatgaaatgatccttgctgctgctgaaggcttagctgaccag
gtgaccccagagcatgttgacaaaggccttatttatccacccttttcctgcatcaggaag
atatcagccaacatcgcagcccgcgttgctgcaaaagcctatgaccttggattggctagc
catctccctcgcccaaaagacttggtgaagtacgctgagagctgcatgtacagccccatt
taccgttcttatagatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326769
Entry
4326769           CDS       T01015                                 
Name
(RefSeq) NADP-dependent malic enzyme, chloroplastic
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00620  Pyruvate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Module
osa_M00169  CAM (Crassulacean acid metabolism), light
osa_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4326769
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4326769
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     4326769
SSDB
Motif
Pfam: Malic_M malic AAA_7
Other DBs
NCBI-GeneID: 4326769
NCBI-ProteinID: XP_015621553
UniProt: P43279
LinkDB
Position
1:complement(4739273..4744563)
AA seq 639 aa
MLSARAAATAAAAAASPLWKRGEGGSSGSGSGCTSCREVRRRAAAVRVRAAAPRRVEAVA
MESAAETEKKEEVAAAGGGVEDMATEEVPVTPWAFSVASGYTLLRDPHHNKGLAFSEKER
DAHYLRGLLPPAVVSQDLQVKKIMHNLRQYSVPLQRYMAMMDLQERNERLFYKLLIDNVE
ELLPVVYTPTVGEACQKYGSIFRQPQGLYVSLKDKGKVLDVLRNWPERNIQVIVVTDGER
ILGLGDLGCQGMGIPVGKLSLYTALGGVRPSACLPITIDVGTNNEQLLNDEFYIGLRQRR
ATGKEYHELMEEFMSAVKQIYGEKVLIQFEDFANHNAFDLLAKYSKSHLVFNDDIQGTAS
VVLAGLLSSLKVVGGTLAEHTYLFLGAGEAGTGIAELIALEISKQTKAPIEECRKKVWLL
DSKGLIVNSRKESLQAFKKPWAHEHEPVTTLLDAVQSIKPTVLIGTSGVGKTFTKEVIEA
MASFNERPVIFSLSNPTSHSECTAEEAYNWSQGRAVFASGSPFDPVEYNGKIHVPGQSNN
AYIFPGFGLGVVISGAVRVHEDMLLAASETLADQATQENFEKGSIFPPFTNIRKISARIA
ASVAAKAYELGLATRLPQPRDLEKYAESCMYTPVYRSYR
NT seq 1920 nt   +upstreamnt  +downstreamnt
atgctgtccgcgcgcgccgccgccaccgccgccgccgccgccgcctccccgctgtggaag
cgcggcgagggtggcagcagcgggagcgggagcggatgcacgagctgcagggaggtgcgg
aggagggccgcggcggtgagggtccgtgcggcggcgccgaggagggtggaggcggtcgcg
atggagtccgcggcggagaccgagaagaaggaggaggttgcggcggccggcggcggggtt
gaggacatggctaccgaggaggtgcccgtcacgccatgggccttctccgtcgcgagtggt
tacacccttttgagggatccacatcacaacaagggccttgcctttagtgagaaggagcgg
gatgctcattacttacgtggccttcttcctccggcagttgtgtctcaggatcttcaagtg
aagaagatcatgcataatcttcgccagtacagtgtacctttgcagcgttacatggccatg
atggatctccaggagaggaacgagaggctcttctacaagcttttgattgataatgtggag
gagcttctccctgtggtgtatacaccaacagtaggtgaggcctgccagaagtatgggagc
atatttagacaaccacagggtctctatgtcagcttgaaggacaagggaaaggttcttgat
gtgctaaggaactggccagagagaaacattcaagttattgttgttactgatggtgagcgc
attttggggcttggagatttgggttgtcagggaatgggtattcctgttggtaaactttct
ctgtacactgcccttggaggagttcgcccgtcagcttgtttacctatcacgattgatgtt
ggtacaaacaatgagcaattgttgaatgatgaattctacattgggctccggcaaaggcgt
gctactggcaaggagtaccatgagctcatggaagaatttatgagtgccgttaagcaaatc
tatggtgagaaagttctgatacagtttgaggacttcgccaatcacaacgcatttgatttg
cttgcaaaatacagcaagagtcatcttgttttcaatgatgatatccagggaacagcatct
gtggtccttgcaggtcttttatcatcactaaaggtggttggtggaaccctggctgaacac
acttatttgttccttggtgctggtgaggctggaactggtattgcagaactcattgctctt
gagatttcaaaacagacaaaggctccaattgaggagtgccgcaagaaggtttggctgctg
gattcaaaggggttgatcgttaactcacgaaaagaatccctccaggcatttaaaaagcct
tgggcacatgagcatgaacctgtaacgacactgttagatgctgtccagtccatcaaacct
actgtgctgattggaacatccggagttggcaaaacttttactaaagaagttattgaggcc
atggcttcctttaacgagcgacccgtcattttctctctgtcaaaccccacatcacactct
gagtgtactgctgaagaagcatataattggagccagggtcgtgcagtatttgccagcggc
agtccgtttgaccctgtggagtacaatggaaagatacatgtgccaggccagtcgaacaat
gcctacattttccctggattcggcctcggtgtcgtaatctctggagctgtccgtgttcac
gaggatatgcttctagctgcctcggaaacactagctgatcaggccactcaggagaacttt
gagaagggatcgatcttcccgcccttcacaaacatcagaaagatttctgctcgcattgcc
gcaagcgtggctgcaaaagcctatgaacttggactggcgacccggctgcctcaacccagg
gatctggagaaatacgcagagagctgcatgtacacccccgtataccgcagctaccggtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4338007
Entry
4338007           CDS       T01015                                 
Name
(RefSeq) NADP-dependent malic enzyme, chloroplastic-like
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00620  Pyruvate metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01200  Carbon metabolism
Module
osa_M00169  CAM (Crassulacean acid metabolism), light
osa_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    4338007
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4338007
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     4338007
SSDB
Motif
Pfam: Malic_M malic AAA_5 RsgA_GTPase
Other DBs
NCBI-GeneID: 4338007
NCBI-ProteinID: XP_015640686
UniProt: Q6T5D1 Q0DK77
LinkDB
Position
5:complement(5293607..5297427)
AA seq 570 aa
MAGGGVEDTYGEDRATEDQLITPWSFSVASGYTLLRDPRHNKGLAFSEAERDAHYLRGLL
PPSIVSQELQEKKLMHNLRNYTVPLQRYIAMMDLQERNERLFYKLLIDNVEELLPVVYTP
TVGEACQKYGSIYRRPQGLYISLKDKGKILEVLKNWPERSIQVIVVTDGERILGLGDLGC
QGMGIPVGKLSLYTALGGVRPSACLPITIDVGTNNESLLNDEFYIGLKQRRATGEEYHEL
LEEFMTAVKQNYGEKVLVQFEDFANHNAFDLLAKYSKSHLVFNDDIQGTASVVLAGLIAA
LKVVGGTLADHTYLFLGAGEAGTGIAELIALEMSKQTEIPINDCRKKVWLVDSRGLIVES
RKESLQHFKQPFAHEHEPVKTLLEAVQSIKPTVLIGTSGVGKTFTQEVVEAMAAFNEKPV
IFALSNPTSHSECTAEEAYTWTKGSAVFASGSPFDAVEYEGKTYVPGQSNNAYIFPGFGL
GVVISGAIRVHDDMLLAASEALAEQVSEDNFARGLIFPPFTNIRKISAHIAAKVAAKAYE
LGLASRLPRPDDLVKYAESCMYTPAYRCYR
NT seq 1713 nt   +upstreamnt  +downstreamnt
atggccggcggcggcgtggaggacacgtacggcgaggacagggccaccgaggatcagctc
atcaccccatggtccttctccgtcgccagcgggtacacgctgctgagagacccgcggcac
aacaagggtttggccttctcggaggcggagcgcgacgcgcactacctccgcggcctcctc
ccgccatccatcgtctcgcaggagctccaggagaagaagctcatgcacaacctccgcaac
tacaccgtccccctccagcgctacatcgccatgatggacctccaggagaggaatgagagg
ctgttctacaagctcctgatcgacaacgtggaggagctgctgccggtggtgtacacgccg
acggtcggggaggcctgccagaagtacggcagcatctacaggcggccacagggcctgtac
atcagcctcaaggacaaggggaagatccttgaggtgctcaagaactggccggagaggagc
atccaggtgatcgtcgtcaccgacggcgagcgcattcttggccttggagatcttggttgt
cagggaatgggtattcctgtcggcaaactgtctctgtacactgcccttggaggagttcgc
ccatcagcttgccttccaatcacaattgatgttggtaccaacaatgagtcactgctcaac
gacgaattctacattggactcaagcaacgccgtgctaccggagaggaataccacgagctt
cttgaggagtttatgaccgcagttaagcaaaactacggcgagaaagtgctcgttcagttt
gaagactttgccaaccacaatgcttttgacttgcttgcaaagtacagcaagagccacctt
gtcttcaacgacgacattcagggaacagcatcagtggtcctcgcaggtctgattgcggcg
ctcaaggtggtcggtggaactcttgcagatcacacttacctgttccttggcgccggtgag
gctggaactggcatcgcagagctcattgccctcgagatgtcaaagcagacggagattccg
atcaatgattgccggaagaaggtgtggctggtggactcgagggggctgatcgtggagtcg
aggaaggagtcgctgcagcacttcaagcagccattcgcgcacgagcacgagccggtgaag
acgctgctggaggccgtgcagtccatcaagccgaccgtgctcatcggcacttccggcgtc
ggcaagacattcacccaggaggtcgtcgaggccatggccgccttcaacgagaaacctgtc
atcttcgcgctctccaacccgacgtcgcactcggaatgcaccgcggaggaggcatacacc
tggaccaagggaagtgcggtgttcgcgagcgggagcccgttcgacgcggtggagtacgag
gggaagacgtacgtgccggggcaatcgaacaacgcctacatcttcccggggttcgggctg
ggcgtggtgatctcgggcgccatccgcgtccacgacgacatgctgctggcggcgtcggag
gcgctggcggagcaggtgagcgaggacaacttcgccagggggctcatcttcccgcccttc
accaacatccgcaagatctccgcacacatcgccgccaaggtcgccgccaaggcgtacgag
ctcggcctcgccagccgcctcccgcgccccgacgacctcgtcaagtacgccgagagctgc
atgtacaccccggcctaccgctgctaccgctga

DBGET integrated database retrieval system