KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324745
Entry
4324745           CDS       T01015                                 
Name
(RefSeq) sorting nexin 1
  KO
K17917  sorting nexin-1/2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4324745
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4324745
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:osa04990]
    4324745
Membrane trafficking [BR:osa04131]
 Endocytosis
  Macropinocytosis
   Sorting nexins
    4324745
Domain-containing proteins not elsewhere classified [BR:osa04990]
 Phox homology (PX) domain-containing proteins
  Sorting nexins
   4324745
SSDB
Motif
Pfam: Vps5 PX LBP_M Ax_dynein_light
Other DBs
NCBI-GeneID: 4324745
NCBI-ProteinID: XP_015620548
UniProt: Q5N7G9 Q0JHI3
LinkDB
Position
1:complement(37316219..37320683)
AA seq 399 aa
MSQERSQSQSPRSPASAAGVPFLSISVTDPVKMGTGVQAYISYRVITKTNLPDFEGQEKI
VIRRYSDFEWLHDRLAEKYKGIFIPPLPEKNAVEKFRFSKEFIELRRQALDLFVNRIASH
PELKQSGDLKIFLQADEEKMDRERSYETGIFKKPSDFLQMFKDVQSKVSDVVLGKEKPVE
ESSPEYEKLKNYIFELENHLAEAQKQAFRLVKRHRELGQSLADFGKAIKLLGACEGDSLE
KVFSEVGSKSEMLSVKLQREADNLLFNFEEPLKDYVRAVQSIKATMVDRANAFRQHHDLF
QQKEYKGVNLEKLKFVNPDKFSELEAEVRELTADSEEATKRFEHIVAVMNEELARFQEQK
TADIGFAFHEFAKGQAKLAKDIADAWRGVLPKLEACSTS
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgtcgcaggagaggagccagtcgcagagcccccggtcgccggcgtcggcggctggggtg
ccgttcctgtcgatctccgtcacagatcctgtgaagatgggtaccggagtccaggcctac
atctcctatcgcgtcatcaccaagaccaacctgcctgactttgaggggcaagagaaaatt
gttatccggcgctatagtgactttgagtggttgcatgatcgtcttgctgagaagtacaaa
ggcatttttatacctccccttccagagaagaatgctgttgaaaaattccggtttagcaaa
gagttcattgaattacggcgtcaagccctggatctatttgtcaatagaatagcttcacat
cctgaactcaagcaaagtggagatttgaagatatttttgcaggcagatgaagagaaaatg
gatagagaaaggtcttatgaaactggtatattcaagaagccttctgatttcttacagatg
tttaaggatgtacaatcaaaagtcagtgatgttgttctgggaaaagaaaagcctgtggag
gaatctagtcctgaatatgaaaagcttaaaaattacatatttgagctagaaaaccattta
gcagaggcacagaaacaagcattccgtcttgtgaaaagacaccgagaacttgggcaatct
ttggcggactttggtaaggctattaagcttttaggtgcttgcgaaggggactccttggaa
aaagttttttcagaagttggatcaaagtcagagatgttatcagtaaagctgcaaagagag
gcagacaaccttctctttaactttgaagagcctttgaaagattatgtacgtgctgtgcag
tcaataaaagcaactatggtggatcgagccaatgctttcaggcagcatcatgatttattt
cagcagaaggaatataaaggggttaatctcgaaaaattgaagttcgtgaaccctgataaa
ttttctgaactagaagctgaggtccgagagttgacagcagacagtgaggaggctacaaag
aggtttgagcacatagttgcagtaatgaatgaagagcttgcacgtttccaagagcagaaa
acagctgatattggattcgcattccatgaatttgccaaaggccaagcaaagttagctaaa
gatattgctgatgcatggcgaggcgtcctcccaaagctcgaagcctgttccacttcataa

DBGET integrated database retrieval system