KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324941
Entry
4324941           CDS       T01015                                 
Name
(RefSeq) bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase
  KO
K15849  bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase [EC:2.6.1.1 2.6.1.78 2.6.1.79]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00350  Tyrosine metabolism
osa00360  Phenylalanine metabolism
osa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
osa00950  Isoquinoline alkaloid biosynthesis
osa00960  Tropane, piperidine and pyridine alkaloid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00040  Tyrosine biosynthesis, chorismate => arogenate => tyrosine
osa_M00910  Phenylalanine biosynthesis, chorismate => arogenate => phenylalanine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    4324941
   00360 Phenylalanine metabolism
    4324941
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    4324941
  09110 Biosynthesis of other secondary metabolites
   00950 Isoquinoline alkaloid biosynthesis
    4324941
   00960 Tropane, piperidine and pyridine alkaloid biosynthesis
    4324941
Enzymes [BR:osa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     4324941
    2.6.1.78  aspartate---prephenate aminotransferase
     4324941
    2.6.1.79  glutamate---prephenate aminotransferase
     4324941
SSDB
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 OKR_DC_1 Asp_aminotransf
Other DBs
NCBI-GeneID: 4324941
NCBI-ProteinID: XP_015641332
UniProt: Q5N9Z8 A3A017
LinkDB
Position
1:37779495..37782865
AA seq 458 aa
MAASTSATSFSTPTKPASSSSSSSSPNSVCFARASGRCRMASVVVRAEAVDATISPTVSA
LRPSKTMAITDQATALRQAGVPVIGLAAGEPDFDTPHVIAEAGMNAIKDGYTRYTPNAGT
LELRKAICNKLQEENGISYSPDQVLVSNGAKQCITQAVLAVCSPGDEVLIPAPYWVSYPE
MATLAGATPVILPTSISENFLLRPELLASKINEKSRLLILCSPSNPTGSVYPKELLEEIA
DIVKKYPRLLVLSDEIYEHIIYQPAKHTSFASLPGMWDRTLTVNGFSKAFAMTGWRLGYL
AAPKHFVAACGKIQSQFTSGASSISQKAGLAALNLGYAGGEAVSTMVKAFQERRDYLVKS
FKELPGVKISEPQGAFYLFIDFSSYYGSEVEGFGTIKDSESLCMFLLEKAQVALVPGDAF
GDDKCIRMSYAAALSTLQTAMEKIKEAVALIKPRVAAK
NT seq 1377 nt   +upstreamnt  +downstreamnt
atggcggcctccacctccgccacctccttctccactcccaccaagcccgcctcctcctcc
tcctcctcctcaagtcccaactccgtctgcttcgccagggcgtcggggaggtgcaggatg
gcgtcggtggtggtgagggcggaggcggtggacgcgaccatcagcccgacggtgagcgcg
ctgcggccgtccaagaccatggccatcaccgaccaggccacggcgctgcggcaggctggc
gtcccggtcatcggcctcgccgccggggagcccgacttcgacacgccgcacgtgattgct
gaggctgggatgaatgcaattaaggatggttatacaaggtacactcctaatgctgggact
ttggagctgagaaaggctatctgcaataaactccaagaggaaaatgggatatcctacagt
ccagatcaggtgctggtgagcaatggagctaagcaatgcattacgcaagccgtacttgcc
gtttgctcacctggtgatgaggttttgataccagcaccatactgggtcagttatcctgag
atggctacattggctggtgcaactccagtgatccttcctacaagcatatcagagaatttc
ttgctaaggccagagctgcttgcttcaaagatcaacgagaaatcgaggcttttgattctc
tgctctccttctaatccaactggatcagtatatccaaaggagctgcttgaagaaatagct
gacatagtcaagaagtatcctaggcttcttgttttgtctgatgagatttatgagcatatc
atctatcagccagcaaaacacacaagctttgcttcattgcctggaatgtgggatagaaca
ttaactgtaaatggtttttctaaggcttttgcaatgacgggctggcgacttggatacctt
gcagccccaaaacattttgttgcagcctgtggaaagatccaaagccagtttacttcaggt
gctagtagcatatcacagaaggcagggctcgctgctttgaaccttggctacgctggtggt
gaagcagtctcaactatggtcaaagcattccaggaacgtcgtgattaccttgtaaaaagt
ttcaaggaactgccaggtgtgaagatatcagagcctcagggtgccttttatttgttcatc
gacttcagctcctactatggatctgaagtagagggttttggcactatcaaggactctgag
tccctctgcatgttcctcttggagaaagcacaggttgcacttgtcccgggcgatgcattt
ggggacgacaaatgcatccgcatgtcatatgctgcagcactatctacgcttcaaactgct
atggagaaaatcaaagaagctgttgcgctgatcaaaccccgtgttgctgctaagtga

DBGET integrated database retrieval system