KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325052
Entry
4325052           CDS       T01015                                 
Name
(RefSeq) DNA polymerase alpha catalytic subunit
  KO
K02320  DNA polymerase alpha subunit A [EC:2.7.7.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03030  DNA replication
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    4325052
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:osa03032]
    4325052
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     4325052
DNA replication proteins [BR:osa03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase alpha / primase complex
    4325052
SSDB
Motif
Pfam: DNA_pol_B zf-DNA_Pol DNA_pol_B_exo1 DNA_pol_alpha_N DUF1744 DNA_pol_B_2 DNA_pol_B_exo2
Other DBs
NCBI-GeneID: 4325052
NCBI-ProteinID: XP_015624973
UniProt: O48653
LinkDB
Position
1:complement(37625808..37636160)
AA seq 1534 aa
MDEGSADAGASGRRSRARGSEAVARSAALERLRAIRDGGARAAAAVQVRIEAPIYDTVAE
EDYAALVARRRKDAGAFIVDDDGLGYADDGREEDWTHRTIHSSSDEGSDGEDGAPRKRKQ
PRPQSKRPPQQSAAAASLSAAAAMMGKQRLSSMFTSSVFRKPGSDRGRDSSLAADSIVDD
VIAEFAPDDNDREERRRRVGRVCAPAPAPTTTAHIKAENVAVDTAMAFRSDNVFEAHEVS
DHGNDMDMELKPDVEMEPKLDTPLGASAELANNSNSLEEPKQEANGEVKIEKVHRLNAKI
KTEDSRNGDMASATAGWMKICGDGDNAGGEGAVAANSNTGVDESSEFELKDGALPFYILD
AYEEPFGANSGTVYLFGKVEVGKRFHSCCVVVKNMQRCIYAIPSSSIFPRDTISRLEKNS
TTSDSSPSLRASLHELASGLKSEIADKLSDFNVSNFAMTPVKRNYAFERTDLPNGEQYVL
KINYPYKDPALPTDLRGQHFHALLGTNNSALELLLIKRKIKGPSWLSISKFLACPATQRV
SWCKFEVTVDSPKDISVLMTSTTLEVPPVVVAAVNLKTIINEKHNVHEIVSASVICCHRV
KIDSPMRSEDWQKRGMLSHFTVMRKLEGSIFPIGLSKESSDRNQKAGSNVLALESSERAL
LNRLMIELSKLDCDVLVGHNISGFDLDVLLHRAQTCKVPSNMWSKIGRLRRSVMPRLTKG
NTLYGSGASPGIMSCIAGRLLCDTYLCSRDLLKEVSYSLTQLAETQLKKERKEVSPHDIP
PMFQSSGALLKLVEYGETDACLALELMFHLSVLPLTRQLTNISGNLWGKTLQGSRAQRVE
YLLLHAFHARKFIVPDKFARSKEFNSTKRKMNPDTEAARPDEADPSIDDEGHHVDQGKTK
KGPSYAGGLVLEPKKGLYDKYVLLLDFNSLYPSIIQEYNICFTTVDRSADGNVPNLPASK
TTGVLPELLKSLVERRRMVKSWLKTASGLKRQQFDIQQQALKLTANSMYGCLGFSNSRFY
AKPLAELITLQGREILQNTVDLVQNNLNLEVIYGDTDSIMIHTGLDDISRAKGIAGKVIQ
EVNKKYRCLEIDLDGIYKRMLLLKKKKYAAIKVALDGSLRENIERKGLDMVRRDWSLLSK
EIGDFCLNQILSGGSCDDVIESIHSSLVQVQEQMRGGQTELEKYIITKSLTKAPEDYPDA
KNQPHVQVALRLKQNGYSGCSAGDTVPYIICSQQDSESTHSGGIAQRARHPEELKRNPDK
WMIDIDYYLSQQIHPVVSRLCASIQGTSPARLAECLGLDSSKFQSRLTESDNQDTSSMLL
SVIDDEDERYRGCEPLRLSCPSCSTTFDCPPVSSLIIGSSSGNVSNPNEGNDASINFWRR
MRCPRCPDDTDESRVSPAVLANQMKRQADSFINLYYKGLLMCDDEGCKYSTHSVNLRVMG
DSERGTICPNYPRCNGHLVRQYTEADLYRQLSYFCYVVDATRCLEKLDQKARLPFEKEFA
ALSQTINLALMEVQKIRDRCAFGWVQLKDLAISI
NT seq 4605 nt   +upstreamnt  +downstreamnt
atggatgagggatccgcggatgcgggcgcctccggccgccgctcgcgcgcccggggctcc
gaggcggtggcgcggtccgcggcgctcgagcgcctccgcgcgatccgcgatgggggcgcc
cgcgccgccgccgccgtccaggtgaggattgaggccccgatctacgacaccgtcgccgag
gaggactacgccgcgctcgtcgcccgccgccggaaggacgcgggggccttcatcgtcgac
gacgacggcctgggctacgccgacgacgggcgggaggaggactggacccaccgcaccatc
cactcctcctccgacgagggctccgacggcgaggatggcgccccccggaagcggaagcag
ccgcgtccgcagtcgaagcgcccgcctcagcagtccgccgccgcggcgtccctctctgcc
gccgccgccatgatggggaagcaacgactctcttccatgttcacctcctccgtgtttagg
aagcctggcagcgaccgcggtagggactcgtcgctggcggccgacagcatcgtggatgac
gtcatcgcggagttcgctcccgacgacaatgaccgcgaggagcggcgccgccgcgttggt
agggtttgtgccccggcgccagcgccaacaacaactgctcacatcaaggctgaaaatgtg
gcagtcgatacggcaatggcgttcagatcggataatgttttcgaggcccatgaggtttca
gatcatggaaatgatatggatatggaattgaagccagacgtggaaatggagcccaaattg
gacacacctcttggtgctagtgctgaattggcgaataatagtaacagcctggaggaaccg
aaacaggaggctaatggggaggttaagatagagaaggtgcatcgtctgaatgctaagatt
aagacggaggacagccggaatggggatatggctagtgcaacagcagggtggatgaagata
tgcggggatggggacaatgcaggaggtgagggagcggtggctgctaacagcaacaccggc
gtggatgaaagctcagaatttgagctgaaggatggagcgctgccattctacatattggat
gcatacgaggagccttttggtgctaattcgggcacagtatatttgtttggaaaggttgaa
gtaggcaagcggttccacagttgttgtgtggttgtaaagaatatgcaaaggtgcatatat
gctattccaagcagttcaatcttcccaagggacaccatatcaaggctagagaagaattcc
actacttctgattcttctccatcacttcgagcaagtctacatgagttagcatcaggattg
aagagcgaaatagctgataagttgtcagacttcaacgtgtcaaattttgcaatgactcca
gtcaagaggaactatgcatttgagaggactgatctaccaaatggggagcagtatgtcttg
aagataaattacccatataaggatccggcgctacctacagaccttcgaggtcaacatttc
catgcattacttgggacgaacaatagtgctcttgaattgcttctcatcaaaaggaagatc
aaggggccttcatggctttcgatctccaaatttttggcatgtccagctactcagcgggtc
agctggtgtaaatttgaagttacagttgatagtcccaaagacatatctgttttgatgaca
agtaccacgttagaagttcctcctgtcgtggttgcagcagttaatcttaaaactatcata
aatgagaaacacaatgtgcatgaaattgtgtcagcatcagtcatatgctgtcaccgtgtg
aaaatagatagtccaatgcgttctgaagattggcagaaacggggaatgctcagccatttt
actgttatgcgcaagcttgaaggcagtatatttcctataggcctctccaaggaatcctct
gataggaaccagaaggctggtagcaatgtgctggcactcgagagcagtgaacgtgcattg
ttaaaccgcttgatgatcgagcttagcaaacttgattgcgatgtacttgtgggacacaat
atttctggatttgacttggacgtccttttgcaccgtgcacagacttgcaaagtaccaagc
aatatgtggtccaagattggtcgtcttaggcgctcagtaatgcccagactcaccaaaggg
aacacactttatgggtctggggcaagtccaggaattatgtcctgcattgctggtcgtctc
ctctgtgatacctacttatgctctcgcgatctcctgaaggaggtgagttattctttgaca
caacttgcagaaacacaattgaaaaaggagaggaaagaggtctctccacatgatattccc
ccaatgttccaatcttcaggagcacttctcaagctggttgaatatggcgagactgatgca
tgtcttgctttggagctcatgtttcatttgagtgttctcccgcttacacgccaattgaca
aatatcagcggtaacctgtggggaaaaactctccagggttctagagctcaaagggtagag
tatctgctgttgcatgcattccatgcaagaaaatttattgtaccggacaagtttgcacgc
agtaaagagtttaactctacaaaacgaaaaatgaaccctgataccgaggctgcaagacct
gatgaagctgatccttcaattgatgacgagggacatcatgttgatcaaggtaaaacgaaa
aaaggtccttcatatgctggtggcttggttttggagcctaaaaagggtctatatgacaag
tatgtgctacttctggactttaacagcctttacccttcgataattcaggaatacaatatc
tgctttactactgttgaccgttctgctgatggcaatgtccctaatttgcccgcttcaaag
accactggtgttttgcctgagttgctaaagagtttggtggagaggagaagaatggttaaa
tcatggcttaagactgcttctggtctcaaaaggcagcagtttgacatccaacagcaagct
ttgaagcttaccgcaaatagcatgtatggctgcttgggcttttccaattccaggttttat
gcaaagccacttgctgagcttattacactgcaaggaagagagatattgcaaaacactgtt
gatctggttcagaataacttaaatttggaggttatctacggtgacacagactctataatg
atacatactggtctggatgacatctccagggcaaaaggaattgcaggaaaagtcattcag
gaggtgaataaaaaataccgctgtctggagattgatcttgatggtatatacaaaagaatg
ctgcttctcaaaaagaagaaatatgctgccattaaagttgcattagatggtagcttacga
gagaacattgagcgcaagggacttgatatggtcagacgtgactggagtttgctgtcaaaa
gaaattggagatttttgcctgaatcaaattttgtctggagggtcatgtgatgacgttatc
gagtcaatccatagttctctcgtgcaggtgcaagagcagatgagaggtggccaaacagaa
ttagaaaaatatatcattacaaagagcttaacaaaagcaccagaagattatccagatgct
aaaaaccaacctcatgttcaggttgctttaagactgaagcaaaatggttattctgggtgc
tctgcaggtgatacagttccctatataatttgctctcaacaggattcagagagtacacat
tcaggaggaatagctcaaagagctagacatccagaggagctgaaaagaaaccctgacaaa
tggatgattgatattgactactatttatcgcagcagattcatcctgtagtttcccgtctg
tgtgcttcgatccagggcaccagcccagctcgcctggctgaatgccttgggcttgattca
tccaagttccaatcaagattgactgagtctgataatcaagatacgtctagcatgctcttg
tctgtaattgatgatgaagatgagagatatcgtggttgtgagcccctgcgattatcatgc
ccaagctgttctactacctttgactgcccccctgtgtctagtctgattattggttctagc
tctggaaatgtatcaaatccaaatgaaggaaatgatgcttccattaatttttggcgtcgg
atgcggtgcccaagatgtccagatgacactgatgagtccagagtttctcctgcagtactt
gcaaaccagatgaaaaggcaggctgatagtttcatcaatctatattataaaggtttactg
atgtgtgatgatgagggttgcaaatactcaacgcacagtgtgaaccttagagtgatgggg
gactctgagagaggaaccatctgccccaactacccacgctgcaatggccacctagtgaga
cagtatacggaggcagatctatacaggcaattgtcatacttttgctatgtagttgatgca
actcgatgtcttgagaagttggaccagaaggcgcggcttccttttgagaaagaatttgcg
gcattaagccaaactattaacttggcattaatggaggttcagaaaatccgagacagatgt
gcatttggctgggttcagttgaaggatcttgcaatatcaatctga

DBGET integrated database retrieval system