KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325200
Entry
4325200           CDS       T01015                                 
Name
(RefSeq) galactinol--sucrose galactosyltransferase
  KO
K06617  raffinose synthase [EC:2.4.1.82]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4325200
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.82  galactinol---sucrose galactosyltransferase
     4325200
SSDB
Motif
Pfam: Raffinose_syn
Other DBs
NCBI-GeneID: 4325200
NCBI-ProteinID: XP_015621501
LinkDB
Position
1:complement(3598449..3602206)
AA seq 840 aa
MSCCGSHTKTSINWAQISLPSLQQSPRLSKTQANQSFHLFFQFKDLQASRKLKASLAMAP
NLSKAKDDLIGDVVAVDGLIKPPRFTLKGKDLAVDGHPFLLDVPANIRLTPASTLVPNSD
VPAAAAGSFLGFDAPAAKDRHVVPIGKLRDTRFMSIFRFKVWWTTHWVGTNGRDVENETQ
MMILDQSGTKSSPTGPRPYVLLLPIVEGPFRACLESGKAEDYVHMVLESGSSTVRGSVFR
SAVYLHAGDDPFDLVKDAMRVVRAHLGTFRLMEEKTPPPIVDKFGWCTWDAFYLKVHPEG
VWEGVRRLADGGCPPGLVLIDDGWQSICHDDDDLGSGAEGMNRTSAGEQMPCRLIKFQEN
YKFREYKGGMGGFVREMKAAFPTVEQVYVWHALCGYWGGLRPGAPGLPPAKVVAPRLSPG
LQRTMEDLAVDKIVNNGVGLVDPRRARELYEGLHSHLQASGIDGVKVDVIHLLEMVCEEY
GGRVELAKAYFAGLTESVRRHFNGNGVIASMEHCNDFMLLGTEAVALGRVGDDFWCTDPS
GDPDGTFWLQGCHMVHCAYNSLWMGAFIHPDWDMFQSTHPCAAFHAASRAVSGGPVYVSD
AVGCHDFDLLRRLALPDGTILRCERYALPTRDCLFADPLHDGKTMLKIWNVNKFSGVLGA
FNCQGGGWSREARRNMCAAGFSVPVTARASPADVEWSHGGGGGDRFAVYFVEARKLQLLR
RDESVELTLEPFTYELLVVAPVRAIVSPELGIGFAPIGLANMLNAGGAVQGFEAARKDGD
VAAEVAVKGAGEMVAYSSARPRLCKVNGQDAEFKYEDGIVTVDVPWTGSSKKLSRVEYFY
NT seq 2523 nt   +upstreamnt  +downstreamnt
atgagttgttgtggctcccacacaaaaacctctataaattgggcgcaaattagcctccca
tctcttcagcaaagccccaggcttagcaaaacacaagcaaaccaaagcttccatctcttc
ttccagttcaaagatctccaagcctccaggaaactcaaggccagcctcgccatggcgccc
aacctcagcaaggccaaggacgacctgatcggcgacgtggtcgccgtcgacgggctgatc
aagccgccgcggttcacgctcaagggcaaggacctcgccgtggacggccacccgttcctc
ctcgacgtgccggccaacatccgcctcaccccggcgtccaccctcgtgcccaactccgac
gtccccgccgccgccgccggcagcttcctcggcttcgacgcgccggcggccaaggaccgc
cacgtggtgcccatcggtaagctccgcgacacgaggttcatgagcatcttccgtttcaag
gtgtggtggacgacccactgggtgggtacaaacggcagggacgtggagaacgagacccag
atgatgatcctagaccagtcggggacgaagtcctcgccgaccggccctcggccctacgtc
ctcctcctcccgatcgtcgaggggcccttccgggcctgcctcgagtccgggaaggcggag
gactacgtgcacatggtcctcgagagcgggtcgtccacagtcaggggctccgtgttccgg
agcgctgtgtacctgcacgcgggggacgacccgtttgacctggtcaaggacgccatgagg
gtggtccgtgcccacctcggcacgttccgcctcatggaggagaagacgccgccgccgatc
gtcgacaagttcgggtggtgcacgtgggacgcgttctacctcaaggtgcacccggagggg
gtgtgggagggcgtgcggcggctcgccgacggcgggtgcccgccggggctggtgctgatc
gacgacggctggcagtcgatctgccacgacgacgacgacctgggcagcggcgccgagggg
atgaaccgcacgtcggccggcgagcagatgccgtgcaggctgatcaagttccaggagaac
tacaagttcagggagtacaagggcggcatgggcggcttcgtgagggagatgaaggcggcg
ttcccgacggtggagcaggtgtacgtgtggcacgcgctgtgcgggtactggggcggcctc
cgccccggcgcgccgggcttgccgccggcgaaggtcgtcgcgccgaggctctcgccgggc
ttgcagcgcaccatggaggacctcgccgtcgacaagatcgtcaacaacggcgtcgggctc
gtcgacccgcgccgcgcgcgggagctctacgaggggctccactcccacctccaggcctcc
ggcatcgacggtgtcaaggtcgacgtcatccatctgctggagatggtgtgcgaggagtac
ggcggtcgggtggagctcgcgaaggcctacttcgctgggctgacggagtcggtgcggcgc
cacttcaacggcaacggcgtgatcgcgagcatggagcactgcaacgacttcatgctgctg
ggcacggaggcggtggcgctgggccgcgtcggcgacgacttctggtgcaccgacccctcc
ggcgaccccgacggcaccttctggctgcagggctgccacatggtgcactgcgcctacaac
tctctgtggatgggcgccttcatccacccggactgggacatgttccagtccacccacccc
tgcgccgccttccacgccgcctcccgcgccgtctccggcggccccgtctacgtcagcgac
gccgtggggtgccacgacttcgacctgctccgccgcctcgcgctgccggatgggaccata
ctccggtgcgagcgctacgcgctgccgacgcgcgactgcctgttcgccgacccgctccat
gacgggaagacgatgctcaagatctggaacgtgaacaagttctccggcgtgctcggcgcg
ttcaactgccagggcggcgggtggagccgcgaggcgcggcggaacatgtgcgccgcgggg
ttctccgtccccgtcaccgcgcgcgcctcccccgccgacgtcgagtggagccacggcggc
ggcggcggcgaccgcttcgccgtctacttcgtcgaggcgcggaagctgcagctgctccgc
cgcgacgagtccgtcgagctcacgctcgagccgttcacctacgagctcctcgtggtggcg
cccgtgcgggccatcgtctcgccggagctggggatcggcttcgcgcccatcgggctcgcc
aacatgctgaacgccggcggcgccgtgcagggcttcgaggcggcgaggaaggacggcgac
gtggcggcggaggtggcggtgaagggcgccggggagatggtggcgtactcgtcggcgagg
cctaggctgtgcaaggtgaacggccaggatgcggagttcaagtacgaggacggcatcgtc
accgtcgatgtgccgtggaccgggtcgtcgaagaagctgtcgcgtgtcgagtacttttac
tag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4340274
Entry
4340274           CDS       T01015                                 
Name
(RefSeq) probable galactinol--sucrose galactosyltransferase 6
  KO
K06617  raffinose synthase [EC:2.4.1.82]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4340274
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.82  galactinol---sucrose galactosyltransferase
     4340274
SSDB
Motif
Pfam: Raffinose_syn
Other DBs
NCBI-GeneID: 4340274
NCBI-ProteinID: XP_015643895
LinkDB
Position
6:complement(3675569..3678997)
AA seq 841 aa
MSVPVARRLLMISTTRATPPASSSPLLPRPRTIYTFPSRAFPPIASAPLPSSSRRCQRRS
RCAASSSEMTVTSSVKVAGGELSVHGRTVLSGVPEAVRASSAAAAGPVDGVFLGGDFAEP
ASRHVVSLGAMRGVRFMACFRFKLWWMAQRMGEKGGDVPHETQFLLVESKAGVDGGGGDA
SYLVFLPLVEGAFRASLQGGGAGGDELQLCVESGDAGTRAASFDRALFVGAADSDPFAAI
AGAVAAAKSCLKTFRIRAEKKLPGIVDYFGWCTWDAFYQDVTQEGVEAGLRSLTAGGAPP
KFVIIDDGWQSVGTDHQNPDDTGADAKDKQPLLARLTGIKENSKFQDGDDPAAGIKTVVR
AAKEKYGLKYVYVWHAITGYWGGVRPGVAGMEGYHSNMQFPNVSPGVVENEPGMKTDVLT
TQGLGLVHPRAVYRFYDELHAYLAAAGVDGVKVDVQCILETLGAGHGGRVSLTRQFHQAL
DASIAKNFPENGIIACMSHHTDALYCAKQTAVVRASDDFYPRDPVSHTIHIASVAYNSVF
LGEFMLPDWDMFHSLHPAGDYHGSARAISGGPVYVSDAPGKHNFELLKKMVLPDGSVLRA
WLPGRPTKDCLFTDPARDGVSLLKIWNMNKFTGVLGVYNCQGAAWSSVEKKNIFHKTGAE
ALSCGVKGSDVHLIADAATDSEWNGDCAVYRHASADLVVLPNGAALPISLKVLEHDILTV
SPIKDLAPGFRFAPIGLVDMFNSGAAVEGLTYHRLDGVKSLSNGSASTLPELQSLSSQAI
GLVCMEVRGCGKFGAYSSVRPRKCMLGSAQVEFTYDSSSGLVILDLETMPKERVHKIVVE
L
NT seq 2526 nt   +upstreamnt  +downstreamnt
atgtccgtgccggtggcgcgaaggctgctcatgatctccaccacccgcgccacgccgccc
gcctcctcctctccccttctcccgcgcccgcgcaccatatataccttcccttcccgcgca
tttccccccatcgcatccgcccctctcccctcctcttctcgccggtgccagaggcggagc
aggtgcgccgcgtcgtcgtcggagatgacggtcacgtcgtcggtgaaggtcgctggtggg
gagctctcggtccatgggcggacggtgctgtccggggtgccggaggcggtgcgtgcgtcg
tccgccgcggcggcggggcccgtcgatggggtcttcctcggcggagacttcgccgagccg
gcatcccgccacgtcgtctccctcggcgcgatgaggggggtgcgattcatggcgtgcttc
cggttcaagctgtggtggatggcgcagaggatgggggagaagggcggcgacgtgccgcac
gagacgcagttcctgctggtggagtccaaggccggcgtcgatggcggcgggggtgacgcg
tcgtacctcgtcttcctcccgctcgtcgagggcgcgttccgggccagcctccaggggggc
ggcgcgggcggcgacgagctccagctctgcgtcgagagcggcgacgcgggcacgcgcgcc
gcgtcgttcgaccgcgcgctcttcgtcggcgccgcggactccgaccccttcgccgccatc
gccggcgccgtcgccgccgccaagtcctgcctcaagacgttccgcatccgcgccgagaag
aagctcccgggcatcgtcgactacttcgggtggtgcacctgggacgccttctaccaggac
gtcacccaggagggcgtcgaggccggcctccgcagcctcaccgccggtggcgcgccgccc
aagttcgtcatcatcgacgacggctggcagtccgtcggcaccgaccaccagaaccccgac
gacaccggcgccgacgccaaggacaagcagccgctcctcgcgcggctcaccggaatcaag
gagaacagcaagttccaggacggcgacgacccggccgccggcatcaagacggtggtgcgc
gccgcgaaggagaagtacggcctcaagtacgtctacgtctggcacgccatcaccggctac
tggggcggcgtccgccccggcgtcgcggggatggaggggtaccactccaacatgcagttc
cccaacgtctcgccgggcgtcgtcgagaacgagcccggcatgaagaccgacgtgctcacc
acccaggggctcgggctcgtgcacccgcgcgccgtgtaccgcttctacgacgagctccac
gcctacctcgccgccgccggcgtcgacggcgtcaaggtcgacgtgcagtgcatcctggag
acgctcggcgccggccacggcggccgcgtctcgctcacccgccagttccaccaggccctc
gacgcctccattgccaagaacttccctgagaacggcatcatcgcctgcatgagccaccac
accgacgccctctactgtgctaagcagacggcagtggtgagagcatcggatgatttctac
ccgagggatccggtgtctcacacgatccacattgcctcggtggcgtacaacagcgtattc
ctcggcgagttcatgctcccggattgggacatgttccactctcttcatcctgccggcgac
taccacggatcggcgagggcgatcagcggcggccctgtctatgtcagtgatgcccctggg
aagcacaactttgagctgctgaagaagatggtcttgcccgatggctccgttcttcgcgcg
tggctacctggccggccaaccaaggactgcctcttcaccgatccggcgcgtgacggcgtc
agcttgctgaagatttggaacatgaacaagttcaccggagtgctcggagtctacaattgc
cagggcgcggcatggagctctgtggagaagaagaacatcttccacaagactggcgccgag
gccctttcttgtggcgtcaagggcagtgacgtccatcttatcgccgacgccgcgacagat
tccgagtggaacggtgattgtgcggtgtaccgtcatgccagtgctgatcttgtagtcctt
ccaaatggcgcagcactgcccatctccctcaaggtcttggaacatgacatcctcaccgtg
tccccaatcaaggatttggcacccggattcaggtttgcaccaatcgggctagtcgacatg
ttcaacagcggggcagcggtcgaaggcctgacctatcatcgtctcgacggcgtaaagtca
ctcagcaatggctctgcttccaccttgcctgagcttcagagcttgagctcccaggccatc
ggattggtctgcatggaagtgaggggatgtggaaagtttggtgcctactcttcagtcagg
ccaagaaagtgcatgctaggctcagctcaggtggagttcacctatgattcctcatctggg
ctggtgatccttgacctggagaccatgcccaaggaaagggttcacaagattgttgttgag
ttgtaa

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4342703
Entry
4342703           CDS       T01015                                 
Name
(RefSeq) probable galactinol--sucrose galactosyltransferase 2 isoform X1
  KO
K06617  raffinose synthase [EC:2.4.1.82]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4342703
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.82  galactinol---sucrose galactosyltransferase
     4342703
SSDB
Motif
Pfam: Raffinose_syn
Other DBs
NCBI-GeneID: 4342703
NCBI-ProteinID: XP_015646880
UniProt: A0A0P0X431 Q6ZLJ9
LinkDB
Position
7:complement(5890566..5894144)
AA seq 763 aa
MTVTPQITVSDGRLAVRGRTVLTGVPENVTAAHASGAGLVDGAFVGADAGEAKSHHVFTF
GTLRECRFMCLFRFKLWWMTQRMGSSGRDVPLETQFMLIEVPATAAGDGHDGGGDGEPVF
VVMLPLLEGKFRAALQGNDDDELQICIESGDKAVQTEQGVNMVYIHAGTNPFDTITQAIK
AVEKRMQTFHHRDKKKMPSFLDWFGWCTWDAFYTDVTADGVKQGLRSLANGGAPPRFLII
DDGWQQIGTEDDDTDEHPAVAVQEGAQFASRLTGIKENVKFQSKNGGAGEDTPGLRMLVE
EVKGEHGVRQVYVWHAMAGYWGGVAPAPAMERYEAALAYPVQSPGVTANQPDIVMDSLSV
LGLGLVHPRKVLDFYDELHAYLASCGVDGVKVDVQNIIETLGAGHGGRVALTRAYNRALE
ASVARSFPDNGCISCMCHNTDMLYSARQTAVVRASDDFYPRDPASHTIHVASVAYNTVFL
GEFMQPDWDMFHSLHPAAEYHGAARAIGGCPIYVSDKPGNHNFDLLRKLVLPDGSVLRAR
LPGRPTRDCLFSDPARDGESLLKIWNLNNCGGVVGVFNCQGAGWCRVAKKTRVHDAAPGT
LTGAVRADDVDAIAQVAGGDGGGWDGEAVVYAHRARELVRLPRGAALPVTLGALEYEVFH
VCPVRAIAAAPGGAAVAFAPVGLLDMFNAGGAVEECAVDAAAAVALRVRGCGRFGAYFSR
RPARCALDGADVGFTYDGDTGLVAVDLPVPEQEMYRWNLEIHV
NT seq 2292 nt   +upstreamnt  +downstreamnt
atgacggtgacgccgcagatcacggtgagcgacgggaggctggcggtgcgggggcggacg
gtgctgaccggcgtgccggagaacgtgacggcggcgcacgcgtccggcgccgggctcgtc
gacggcgccttcgtcggcgccgacgccggcgaggccaagagccaccacgtcttcaccttc
ggcacgctccgggaatgccggttcatgtgcctgttcaggttcaagctgtggtggatgacg
cagaggatgggctcctccggccgcgacgtcccgctcgagacccagttcatgctcatcgag
gtccccgccaccgccgccggcgacggccacgacggcggcggcgacggcgagccggtgttc
gtggtgatgctgccgctgctggaggggaagttccgcgcggcgctgcagggaaacgacgac
gacgagctccagatatgcatcgagagcggggataaggcggtgcagacagagcagggcgtg
aacatggtgtacatccacgctgggaccaaccccttcgacacgatcacccaagccatcaag
gcagtggagaagcgaatgcagacgttccaccacagggacaagaagaagatgccgtccttc
ttggattggttcgggtggtgcacatgggacgcgttctacaccgacgtcaccgccgacggc
gtcaagcagggcctccgcagcctcgccaatggcggcgcgccgccgcgcttcctcatcatc
gacgacggctggcagcagatcggcaccgaggacgacgacacggacgaacaccccgccgtc
gccgtccaggagggcgcccagttcgccagccggctcaccggcatcaaggagaacgtcaag
ttccagagcaagaacggcggcgccggcgaggacacgccggggctgaggatgctggtggag
gaggtgaagggggagcacggcgtccggcaggtgtacgtgtggcacgccatggccgggtac
tggggcggcgtggcgccggcgccggcgatggagcggtacgaggcggcgctggcgtacccg
gtgcagtcgccgggggtgacggcgaaccagccggacatcgtcatggactccctctccgtg
ctcggcctgggcctcgtccacccgcgcaaggtgctcgacttctacgacgagctccacgcc
tacctggcgtcgtgcggcgtcgacggcgtgaaggtggacgtgcagaacatcatcgagacg
ctcggcgccggccacggcggccgcgtcgcgctcacgcgcgcctacaaccgcgcgctcgag
gcgtccgtggcgcggagcttcccggacaacggctgcatctcctgcatgtgccacaacacc
gacatgctctacagcgcgcgccagaccgccgtcgtccgcgcctccgacgacttctaccct
cgcgacccggcgtcccacaccatccacgtcgcctccgtcgcctacaacaccgtcttcctc
ggcgagttcatgcagcccgactgggacatgttccatagcttgcacccggcggcggagtac
cacggcgcggcgagggcgatcggcgggtgtccgatctacgtcagcgacaagccggggaac
cacaacttcgatctgctcaggaagctcgtcctccccgacggctccgtgctccgggcgcgc
ctccccggccgccccacccgcgactgcctcttctccgacccggcgcgcgacggcgagagt
ttgctcaagatatggaacctgaacaattgcggcggcgtggtcggggtgttcaactgccag
ggcgccgggtggtgcagggtggccaagaagacgcgcgtgcacgacgcggcgcccgggacg
ctcaccggcgccgtgcgcgccgacgacgtcgacgccatcgcgcaggtcgccggcggcgac
ggcggaggctgggacggggaggccgtggtgtacgcgcaccgggcgcgtgagctggtccgg
ctgccgcgcggcgccgcgctgccggtgacgctcggggcgctcgagtacgaggtgttccac
gtctgccccgtccgcgccatcgccgcggcgccgggcggcgccgccgtcgcgttcgcgccc
gtcgggctcctcgacatgttcaacgccggcggcgccgtcgaggagtgcgccgtcgatgcc
gcagccgccgtggcgctcagggtgcgcggttgcggccggttcggcgcctacttctcgcgg
aggccggcgaggtgcgcgctcgacggcgccgacgtggggttcacctacgacggcgacacg
gggctcgtcgccgtcgacctgccggtgccggagcaggagatgtacaggtggaacctggag
attcacgtctag

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4345925
Entry
4345925           CDS       T01015                                 
Name
(RefSeq) probable galactinol--sucrose galactosyltransferase 1
  KO
K06617  raffinose synthase [EC:2.4.1.82]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    4345925
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.82  galactinol---sucrose galactosyltransferase
     4345925
SSDB
Motif
Pfam: Raffinose_syn
Other DBs
NCBI-GeneID: 4345925
NCBI-ProteinID: XP_015648149
UniProt: Q8W2G5 A0A5S6RCY5
LinkDB
Position
8:24475152..24479470
AA seq 753 aa
MTVGAGVAVQDGGLVALGATVLTEVRDNVLLTPAAGAGMTSGTFVGVRSATAGSRSVFPV
GKLRGLRFICTFRFKMWWMTQRMGTSGRDIPFETQFLLVEAADADGSHLAGDGAAAVYTV
FLPILEGPFRAVLQGNSDDELEICLESGDPAVESFEGTHLVFVGAGSDPFEVITNSVKAV
ERHLQTFTHREKKKMPDMLNWFGWCTWDAFYTDVTSEGVMEGLQSLGKGGTGPKFVIIDD
GWQSVSMDPAGIASLADNSANFANRLTHIKENHKFQLNGRKGHREENPANGLAHIVNEIK
GKHQLKYVYVWHAITGYWGGVRPGADGMEHYESKMQYPVSSPGVQKNEPCDALNSITTNG
LGLVNPDRVFSFYNELHAYLASAGIDGVKVDVQNILETLGAGHGGRVLLARKYHQALEAS
IARNFRDNGIICCMSHNTDNLYSSKRSAVVRASDDFWPRDPASHTIHIASVAYNTVFLGE
FMQPDWDMFHSVHPMAEYHAAARAVGGCAIYVSDKPGNHDFNLLKKLVLPDGSILRAKLP
GRPTRDCLFSDPARDGKSILKIWNLNEHSGVIGAFNCQGAGWCRVGKKNLVHDEQPATVT
GVIRAQDVHHLATVAADGWNGDVIVYSHIGGEVTCLPKNASLPVTLKTREYEVFTVVPLK
KLDNGVSFAAVGLIGMFNSGGAVTAVRYVEDAGVEVRVRGSGTVGAYSSAKPARVVVDSE
AAEFSYDDGCGLVTFELAVPEQELYSWTISIEY
NT seq 2262 nt   +upstreamnt  +downstreamnt
atgacggtgggagccggggtggcggtgcaggacggcggcctggtggcgctgggcgccacg
gtgctgacggaggtgcgcgacaatgtgctcctgacgccggccgccggcgccggcatgacg
agcggcacgttcgtcggagtccgctccgccaccgccggcagccgcagcgtcttccccgtc
gggaagctcaggggattgcggttcatctgcacgttccggtttaagatgtggtggatgacg
cagaggatggggacgtcaggccgcgacatccccttcgagacgcagttcctcctcgtcgag
gccgccgacgccgacggatcacacctcgccggcgacggcgccgccgcggtgtacaccgtg
ttcctcccgatcttggagggaccgttccgagctgtgcttcaggggaactctgatgatgag
ctcgagatttgcctcgagagtggtgacccagctgtggaatcattcgaaggcacgcatctg
gttttcgtcggtgccggatcggatccattcgaagtcatcacaaattctgtcaaggctgtt
gagaggcacttgcagacgtttactcacagggaaaagaagaagatgccagacatgctaaac
tggtttggttggtgcacatgggatgcgttttatactgatgttacttcagaaggagtaatg
gaaggattacagagtctaggaaaaggtggaactggcccaaaatttgtgataattgatgat
ggatggcaatcagttagtatggatcctgcaggaattgcatcattagctgataactcagcc
aactttgcaaacaggttgactcacataaaggagaaccacaaatttcagctaaacgggagg
aaaggtcacagggaagagaatccggcaaatggccttgcacacattgtcaatgaaattaag
ggcaaacatcagctgaagtatgtttatgtgtggcacgcgatcaccggatactggggtgga
gtaaggcctggtgctgatggaatggagcactacgaatcgaagatgcagtacccggtctca
tcaccgggagttcagaagaacgagccatgtgatgctctgaacagcataaccaccaacggc
cttggccttgtgaaccctgacagagtgttcagcttctacaacgagctacacgcctacctt
gcatctgctgggatcgatggagtgaaagtagatgtgcagaacattcttgagacactgggt
gctggccatggtggaagagtgcttctggcaaggaagtatcaccaggctctagaagcttcc
atcgcccggaacttccgcgacaacggcatcatatgctgcatgagccacaacacggataac
ttgtacagttctaagaggagtgctgttgtgagagcttctgatgatttctggcctagagac
cctgcttcccatactatacatattgcatctgttgcatataatactgtatttcttggagaa
ttcatgcaaccagattgggacatgttccatagtgttcacccaatggctgaataccatgct
gcagcaagagcagtcggtggctgtgccatatatgtcagtgacaagcctgggaaccatgac
ttcaatttgctgaagaagctggttcttcctgacggatcgatcctgagagccaaactcccc
ggcaggccaaccagagactgtctgttttcagaccctgcaagggatggcaagagtatcctg
aagatatggaatctgaacgagcactccggtgtgattggcgccttcaattgccagggtgct
ggatggtgcagagtagggaagaagaacctcgtccacgacgagcagccggcgacggtcacc
ggtgtcatccgtgcacaggacgtgcatcacctcgcaaccgttgctgccgatggctggaac
ggcgacgtgatcgtctactcgcacatcggaggggaggtgacctgcctgcccaagaacgcg
tcgttgccggtgacactgaagacgcgagagtacgaggtcttcaccgtcgtaccactgaag
aagctcgacaatggcgtctccttcgccgcggtcgggctgatcgggatgttcaactccggc
ggggcggtgacggcggtgaggtacgtggaggacgccggcgttgaggtcagggtgcgtggc
tccggcacggtcggggcgtactcctcggcgaagccggcgagggtggtggtggattcggag
gcggcggaattctcctacgatgatggatgcggcttggtcacgttcgagctcgccgtgccg
gagcaagaactctactcctggaccatctcgatcgagtactga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9271916
Entry
9271916           CDS       T01015                                 
Name
(RefSeq) probable galactinol--sucrose galactosyltransferase 2
  KO
K06617  raffinose synthase [EC:2.4.1.82]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00052  Galactose metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    9271916
Enzymes [BR:osa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.82  galactinol---sucrose galactosyltransferase
     9271916
SSDB
Motif
Pfam: Raffinose_syn AbiEi_4
Other DBs
NCBI-GeneID: 9271916
NCBI-ProteinID: XP_015628272
UniProt: Q6ATP7 Q10BP8
LinkDB
Position
3:33829472..33834185
AA seq 771 aa
MTVTPRITVAEGRLVAHGRTILTGVADNIALTHASGAGLVDGAFVGATADEPKSLHVFTF
GTLRDLRFMCCFRFKLWWMTQRMGTSGRDVPLETQFMLLESRDGGGGGEAVYVVMLPLLE
GQFRAALQGNDRDELEICIESGDKAVQTAQGTYMVYVHAGANPFDTITQAVKVVERHLQT
FHHREKKKLPSFLDWFGWCTWDAFYTDVTADGVKQGLQSLAEGGTPPRFLIIDDGWQQIG
SENKEDAGNAVVQEGAQFASRLIGIKENTKFQKTTTTAMADGGETAASAAGLKALVEEAK
KEHGVKYVYVWHAMAGYWGGVKPAAEGMEHYESAVAFPVQSPGVMGNQPDIVMDSLSVLG
LGLVHPRMALAFYGELHAYLASCGVDGVKVDAQNIIETLGAGHGGRVSLTRAFHRALEAS
VARSFPDNGCISCMCHNTDMLYSARQTAVVRASDDFYPLDPASHTIHISSVAYNTLFLGE
FMQPDWDMFHSLHPAAEYHGAARAIGGCPIYVSDKPGNHNFELLKKLVLPDGSVLRARLP
GRPTRDCLFVDPARDGASLLKIWNVNKCTGVVGVFNCQGAGWCRITKKTRVHDAAPGTLT
GSVRADDVDAIADVAGTGWTGDAVVYAHRSGELIRLPKGATLPVTLKVLEFELFHVCPVM
TVAPGGGGGGVTFAPIGLLDMFNSGGAVEECDVVRALDAAGEAEAEAEAAVVRLRARGCG
RFGAYSSRRPARCALDAVEVEFSYDADTGLVALDVPVPAHELYKWTVEIQV
NT seq 2316 nt   +upstreamnt  +downstreamnt
atgacggtgacgccgaggataacggtggcggaggggaggctggtggcgcatggccggacc
atcctcaccggcgtggcggacaacatcgcgctgacgcacgcctccggcgccgggctcgtc
gacggcgccttcgtcggcgccaccgccgacgagcccaagagccttcacgtcttcaccttc
ggcaccctccgggatttgaggttcatgtgctgcttccggttcaagctatggtggatgacc
cagcggatgggcacgtccggccgcgacgtcccgctggagacacagttcatgctcctcgag
agccgcgacggcggcggcggcggcgaggcggtgtacgtcgtgatgctgccgctgctggag
gggcagttccgggcggcgctgcagggcaacgaccgcgacgagctcgagatctgcatcgag
agcggtgacaaggcggtgcagacggcgcaggggacgtacatggtgtacgtgcacgccggg
gccaatcccttcgacaccatcacccaagccgtcaaggtggtggagaggcatctgcagacg
ttccaccaccgggagaagaaaaagttgccgtcgttcttggactggttcgggtggtgcaca
tgggacgccttctacaccgacgtcaccgccgatggcgtcaagcaaggcctccaaagcttg
gcggaaggcggcacgccgccgcggttcttgatcatcgacgacgggtggcagcagatcggc
agcgagaacaaggaggatgccggcaatgccgtcgtccaagaaggcgcccagttcgcgagc
aggttgatcgggatcaaggagaacaccaagttccagaagacgacgacgacggcaatggcg
gatggcggcgagacggcggcgtcggcggcggggctgaaggcgttggtggaggaggcgaag
aaggagcacggggtgaagtacgtgtacgtgtggcacgccatggcggggtactggggcggc
gtgaagccggcggcggaggggatggagcactacgagagcgcggtggcgttcccggtgcag
tcgccgggggtgatggggaaccagccggacatcgtcatggactccctctccgtgctcggc
ctcggcctcgtccacccgcgcatggcgctcgccttctacggcgagctccacgcctacctg
gcgtcgtgcggcgtcgacggcgtcaaggtggacgcgcagaacatcatcgagacgctcggc
gccgggcacggcggccgcgtgtcgctcacgcgcgcgttccaccgcgcgctggaggcgtcc
gtggcgcgcagcttccccgacaacggctgcatctcctgcatgtgccacaacaccgacatg
ctctacagcgccaggcagaccgccgtcgtgcgcgcctccgacgacttctaccctctcgac
ccggcgtcgcacaccatccacatctcctccgtcgcctacaacaccctcttcctcggcgag
ttcatgcagcccgactgggacatgttccacagcttgcacccggcggcggagtaccacggc
gcggcgcgggcgatcggcggctgcccgatctacgtcagtgacaagccgggtaaccacaac
ttcgagctgctcaagaagctcgtcctccccgacggctccgtgctccgggcacggctcccc
ggccgccccacccgcgactgcctctttgtcgacccggcccgcgacggcgcaagcttgctc
aagatatggaacgtgaacaagtgcaccggcgtggtgggcgtgttcaactgccagggcgcc
ggctggtgccggatcaccaagaagacgcgcgtccacgacgcggcgccggggacgctcacc
gggtcagtccgcgccgacgacgtcgacgccatcgccgacgtcgccggcacgggctggacc
ggcgacgccgtcgtgtacgcccacagatcaggtgagctgatcaggttgcccaagggagcg
acgctgccggtgacgctcaaggtgctggagttcgagctgttccatgtctgccccgtcatg
acggtggcgccgggcggcggcggcggcggcgttacgttcgcgccgatcggcctgctcgac
atgttcaactccggcggagcggtggaggaatgcgacgtcgtccgtgccctcgacgccgca
ggcgaggccgaggccgaggccgaggccgccgtcgtgcgccttagggcccgtggctgcggc
cggttcggcgcctactcctcccggcggccggcgcggtgcgcgctggacgccgtggaggtg
gagttcagctacgacgccgacacggggctcgtcgcgctcgacgtccccgtgccggcacat
gagttgtacaaatggaccgtggagatccaggtctag

DBGET integrated database retrieval system