KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325273
Entry
4325273           CDS       T01015                                 
Name
(RefSeq) 30S ribosomal protein S20, chloroplastic
  KO
K02968  small subunit ribosomal protein S20
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4325273
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4325273
Ribosome [BR:osa03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    4325273
SSDB
Motif
Pfam: Ribosomal_S20p
Other DBs
NCBI-GeneID: 4325273
NCBI-ProteinID: XP_015624147
UniProt: Q0JKF5 A2ZWI7
LinkDB
Position
1:27922290..27924338
AA seq 196 aa
MATATSTLFSLSSLSASLPSPAQPAPASLSLRAVSPRARLSASYAAFPIGGIGAWAAATP
ASSGRWRRRGLEVVCEAAKTGTATGRRPDSVKKRERQNDRHRIRNHARKAEMRTRMKKVL
KALEKLRKKADATPEDIIQIEKWISEAYKAIDKTVKVGAMHRNTGNHRKSLLARRKKAIE
ILRGWYVPNAEPAATS
NT seq 591 nt   +upstreamnt  +downstreamnt
atggcgaccgccacctccacgctcttctccctctcctccctctccgcctctctcccttcc
cccgcgcagccagccccggcgtctctctccctccgcgccgtctccccgcgggcccgcctg
tccgcctcctacgccgccttccccatcggtgggatcggggcatgggcggcggcgacgccg
gcgtcgtcggggaggtggaggaggaggggactggaggtggtgtgcgaggcggccaagacc
ggcaccgcgaccgggaggcgcccggactcggtcaagaagagggagcggcagaacgaccgg
caccgcatccgcaaccatgcacgcaaggccgagatgcgcaccaggatgaagaaggttttg
aaagcccttgaaaagctgagaaagaaagctgatgccacacctgaagatatcattcaaata
gagaaatggatttctgaggcatacaaagccattgacaagacagtgaaggttggcgccatg
cacaggaatactggtaaccatcgcaagtcccttcttgcgaggaggaagaaggccatcgag
atactccgtggttggtatgttccaaacgctgaacctgctgctaccagctag

DBGET integrated database retrieval system