KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325277
Entry
4325277           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4325277 isoform X1
  KO
K03023  DNA-directed RNA polymerase III subunit RPC3
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    4325277
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4325277
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase III system
   RNA polymerase III
    Pol III specific subunits
     4325277
SSDB
Motif
Pfam: RNA_pol_Rpc82 HTH_9 TFIIE_alpha HTH_IclR Vitellogenin_N
Other DBs
NCBI-GeneID: 4325277
NCBI-ProteinID: XP_015635009
UniProt: Q5QM91 A0A0P0V6L2
LinkDB
Position
1:27938764..27947045
AA seq 506 aa
MVSQHGILLAVAIISDHFGPLVSKVCRCLLRHGALPLQEIVRRLELSPGQVKNSLLVLIQ
HNCVQAFNAPRGNGDKTVTHYLAIFDNIVHRQRFSKFLSIIRADIPESEALLEGLLQNGR
LTFGQLVERTISKVPEGSITPAREEIRMNFNKLVFAHYVERCPKPEPFFDPLVDEQSTSS
RKRAPKTVEIALSIDKKVVNTAALSDAERFSEIPYIMEDASNANDSPRSSISGAKRKHNA
LEGDAELDSTIAENEVLWRANFEKFTFCLKKKFCADRKKPKLKVGTHPIWEAFFEASLME
RDNNSVTSPINGIMERLGQKEGGTSMTLDHITRVLEELNCSPSSEDPDSFILDLSRIVEA
SRNEEIESLVRKKYGQEAFTIFRLLVRERGPVETDKIIDTTILDKQIVHGTLYKLWKDDY
IDTERILSGTGTGNTQYFVWRVKNTFREQFIDNLCHAALNLRQMVNYIAELLLEGSKDDT
KLRNRKNILILALTRHDDSLMLFQDF
NT seq 1521 nt   +upstreamnt  +downstreamnt
atggtgtcgcagcacgggatcctcctcgccgtcgccatcatctccgaccacttcggcccc
ctcgtatccaaggtgtgccgctgcctgctccgccacggcgcgctgccgctgcaggagatc
gtccgccgcctcgagctctcgccggggcaggtgaagaactcgctcctcgtcctcatccag
cacaactgcgtgcaggccttcaatgcccccagaggaaatggtgataagacggtaacgcac
tacctggccatcttcgacaacatcgtgcacagacagcgtttctcaaagttcctttctatc
atccgtgcagacatcccagagtcagaagcgctgcttgaaggattgcttcagaatggtagg
ctaacatttggccaacttgtggagcgaacaatttctaaagtaccagaaggcagtatcaca
ccagcaagggaggaaatacgaatgaacttcaacaaacttgtatttgcacattatgtggag
cgttgcccgaaacctgaacctttctttgatccacttgtagatgaacaatctacctcgtca
aggaaacgtgctccaaaaactgtcgagattgctctttcaattgataagaaagttgtcaat
actgcagctctttctgatgcagaaagattttctgagatcccatacatcatggaagatgca
tccaatgctaatgattctccacgttcttctatttctggtgctaagaggaaacataatgcc
ttagaaggagatgcagagctcgattcaacaattgcagagaacgaagtactttggcgggca
aattttgagaaattcacattctgtctaaagaagaagttttgtgcagaccgaaagaaacct
aagttgaaggttggcacacatcctatctgggaagcatttttcgaggccagtttaatggaa
agggacaacaactctgtgacatctccaataaatggtattatggagaggctaggacagaag
gaaggaggtacatcgatgacacttgatcatataacaagagttttggaggagttgaattgt
agtccttcctcagaggacccagattcattcattttggatttaagcagaattgttgaagca
tctcgaaatgaggagatagagtcgcttgtgagaaagaaatacgggcaagaagcttttaca
atttttaggctattggtcagagaacgcggtccagttgagacagataaaattattgacaca
acaattcttgacaagcagattgttcatggaactttgtataagctttggaaggacgactac
atcgatacagagagaatcctttctggaacaggaacagggaacacacaatattttgtatgg
agagtgaaaaatacattccgggaacagttcatcgataatctatgtcatgctgctttaaac
ctgcggcaaatggtcaattacatagctgaactcctactcgagggctcaaaggatgacaca
aagttgcggaatagaaaaaatattttgatcttagccctgactagacatgacgattctctc
atgctgtttcaggatttttga

DBGET integrated database retrieval system