KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325282
Entry
4325282           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L37a isoform X2
  KO
K02921  large subunit ribosomal protein L37Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4325282
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4325282
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4325282
  Archaea
    4325282
SSDB
Motif
Pfam: Ribosomal_L37ae A2L_zn_ribbon zf-RING_13 DUF5816 zf-FPG_IleRS C1_1 zf-U1 Zn-ribbon_8
Other DBs
NCBI-GeneID: 4325282
NCBI-ProteinID: XP_015622290
UniProt: P0DKK1 P0DKK2
Structure
LinkDB
Position
1:complement(27965707..27968169)
AA seq 92 aa
MTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKFAVKRKAVGIWGCKDC
GKVKAGGAYTMNTASAVTVRSTIRRLREQTEA
NT seq 279 nt   +upstreamnt  +downstreamnt
atgacgaagcgcaccaagaaggctggaattgttggcaaatatggtactaggtatggtgcc
agtttgcgtaagcaaatcaagaagatggaggtttctcagcactccaagtacttctgtgag
ttctgtgggaagtttgccgtgaagaggaaagcagttggaatctggggatgcaaggactgt
gggaaggtgaaggccggtggtgcttacaccatgaacactgctagtgcggtcactgtcagg
agcacaatccgtcgtctgagggagcagactgaagcctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339573
Entry
4339573           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L37a isoform X2
  KO
K02921  large subunit ribosomal protein L37Ae
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4339573
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4339573
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4339573
  Archaea
    4339573
SSDB
Motif
Pfam: Ribosomal_L37ae A2L_zn_ribbon zf-RING_13 DUF5816 zf-FPG_IleRS C1_1 zf-U1 Zn-ribbon_8
Other DBs
NCBI-GeneID: 4339573
NCBI-ProteinID: XP_015640520
UniProt: P0DKK1 P0DKK2
Structure
LinkDB
Position
5:27699715..27701840
AA seq 92 aa
MTKRTKKAGIVGKYGTRYGASLRKQIKKMEVSQHSKYFCEFCGKFAVKRKAVGIWGCKDC
GKVKAGGAYTMNTASAVTVRSTIRRLREQTEA
NT seq 279 nt   +upstreamnt  +downstreamnt
atgacgaagcgcaccaagaaggcaggaatcgttggcaaatatggtaccaggtatggtgcc
agtttgcgtaagcagatcaagaagatggaggtttcccagcactccaagtacttctgcgag
ttctgtggcaagtttgctgtgaagaggaaagcagttggaatctggggatgcaaggactgt
ggcaaggtcaaggctggtggtgcctacaccatgaacactgccagtgcggtcacggtcaga
agcacaatccgtcgcctgagggagcagacagaagcctga

DBGET integrated database retrieval system