KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325286
Entry
4325286           CDS       T01015                                 
Name
(RefSeq) transcription initiation factor TFIID subunit 11
  KO
K03135  transcription initiation factor TFIID subunit 11
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4325286
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:osa03021]
    4325286
Transcription machinery [BR:osa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     4325286
SSDB
Motif
Pfam: TAFII28 BET
Other DBs
NCBI-GeneID: 4325286
NCBI-ProteinID: XP_015647178
UniProt: A0A0P0V6I0 Q5QMA1
LinkDB
Position
1:28009015..28011844
AA seq 211 aa
MKDPFEAAVEEQESPPESPAANEEDAAGAPEGYDGASGSRGPPLRLPPSRAAPSGSGGAA
AAAARGKVVRVQKEQQEEEDDEEDHMEVDLDKLPSGTSDPDKLAKMNAILSQFTEDQMNR
YESFRRSGFQKSNMKKLLASITGSQKISLPTTIVVSGIAKMFVGELVETARIVMTERKDS
GPVRPCHIREAYRRLKLEGKIPRRTVPRLFR
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaaggacccgttcgaggcggcggtggaggagcaggagtcgccgccggagtcgccggcg
gcgaacgaggaggacgcggccggggcgcccgagggatacgacggcgccagcgggtcgcgc
gggcctccgctgcggctgcctccttcgagggccgcgccatcgggctccggtggtgccgcc
gcggccgcggcgaggggtaaggtggtgcgggtccagaaggagcagcaggaggaggaggat
gacgaggaggaccacatggaggtcgacctcgacaagctgccctccggcaccagcgacccc
gacaagctcgccaagatgaatgccatactgtctcaatttacagaagaccagatgaaccgg
tatgagtcattccgcagatctggattccagaaatctaacatgaaaaagctattggcgagc
attactggcagtcaaaagatttctctaccaacaacaattgtagtatcaggaattgcaaag
atgtttgttggtgagcttgttgaaacagctagaatagttatgactgagaggaaagattct
ggaccagtaaggccttgccacatcagagaagcctacagaagattgaaacttgaagggaag
atcccacggcggactgttcccaggctcttccgttag

DBGET integrated database retrieval system