KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325329
Entry
4325329           CDS       T01015                                 
Name
(RefSeq) protein GIGANTEA
  KO
K12124  GIGANTEA
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04712  Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:osa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04712 Circadian rhythm - plant
    4325329
SSDB
Other DBs
NCBI-GeneID: 4325329
NCBI-ProteinID: XP_015649578
UniProt: Q9AWL7
LinkDB
Position
1:complement(4329398..4338490)
AA seq 1160 aa
MSASNEKWIDGLQFSSLFWPPPQDSQQKQAQILAYVEYFGQFTADSEQFPEDIAQLIQSC
YPSKEKRLVDEVLATFVLHHPEHGHAVVHPILSRIIDGTLSYDRNGFPFMSFISLFSHTS
EKEYSEQWALACGEILRVLTHYNRPIFKVDHQHSEAECSSTSDQASSCESMEKRANGSPR
NEPDRKPLRPLSPWITDILLAAPLGIRSDYFRWCGGVMGKYAAGGELKPPTTAYSRGSGK
HPQLMPSTPRWAVANGAGVILSVCDEEVARYETANLTAAAVPALLLPPPTTPLDEHLVAG
LPPLEPYARLFHRYYAIATPSATQRLLFGLLEAPPSWAPDALDAAVQLVELLRAAEDYDS
GMRLPKNWMHLHFLRAIGTAMSMRAGIAADTSAALLFRILSQPTLLFPPLRHAEGVELHH
EPLGGYVSSYKRQLEVPASEATIDATAQGIASMLCAHGPDVEWRICTIWEAAYGLLPLSS
SAVDLPEIVVAAPLQPPTLSWSLYLPLLKVFEYLPRGSPSEACLMRIFVATVEAILRRTF
PSETSEQSRKPRSQSKNLAVAELRTMIHSLFVESCASMDLASRLLFVVLTVCVSHQALPG
GSKRPTGSDNHSSEEVTNDSRLTNGRNRCKKRQGPVATFDSYVLAAVCALSCELQLFPFI
SKNGNHSNLKDSIKIVIPGKTTGISNELHNSISSAILHTRRILGILEALFSLKPSSVGTS
WSYSSNEIVAAAMVAAHVSELFRRSRPCLNALSALKQCKWDAEISTRASSLYHLIDLHGK
TVTSIVNKAEPLEAHLTLTPVKKDEPPIEEKNINSSDGGALEKKDASRSHRKNGFARPLL
KCAEDVILNGDVASTSGKAIASLQVEASDLANFLTMDRNGGYRGSQTLLRSVLSEKQELC
FSVVSLLWQKLIASPEMQMSAESTSAHQGWRKVVDALCDIVSASPTKASAAIVLQAEKDL
QPWIARDDEQGQKMWRVNQRIVKLIAELMRNHDSPEALVILASASDLLLRATDGMLVDGE
ACTLPQLELLEVTARAVHLIVEWGDSGVSVADGLSNLLKCRLSTTIRCLSHPSAHVRALS
MSVLRDILNSGQINSSKLIQGEHRNGIQSPTYQCLAASIINWQADVERCIEWEAHSRRAT
GLTLAFLTAAAKELGCPLTC
NT seq 3483 nt   +upstreamnt  +downstreamnt
atgtcagcttcaaatgagaagtggattgatgggctccagttctcatcactgttctggccc
ccaccacaggattcacaacaaaaacaggcacaaattctggcctatgttgagtactttggc
cagtttacagctgacagtgagcaattccctgaagatatagctcagctaattcaaagttgc
tatccatcaaaagaaaagcgccttgtagatgaagtattagcaacttttgttcttcatcat
cctgagcatggccatgcagttgtgcatccgattctgtcacgcatcatagatgggacactc
agttatgatagaaatggtttcccgttcatgtccttcatctctttatttagccatacttct
gagaaagagtactcggagcagtgggccttggcctgtggagaaattcttagagttctaact
cactacaacaggccaatcttcaaagttgatcaccaacatagtgaagcggaatgtagcagc
acatctgatcaggcctcatcatgtgagtctatggagaaaagggctaacggttctccaaga
aatgaacctgaccggaagccattgaggccactatctccttggatcacagacatattgctt
gctgcacctctgggtattagaagtgactattttagatggtgtggtggagtcatgggaaaa
tacgcagctggtggagaattgaagcctccaacaactgcttacagccgaggatctgggaag
cacccacaacttatgccatccacgcccagatgggctgttgccaatggagctggagttata
ctaagtgtctgtgatgaggaagtagctcgttatgagacagcaaatttgactgcggcagct
gttcctgcacttctattacctccaccgaccacaccattggacgaacatttggttgcgggg
ctccctcctcttgaaccatatgctcgcttgtttcatagatactatgcaattgctactcca
agtgctacccaaaggttgctttttggtcttctcgaggcaccaccatcatgggccccagat
gcacttgatgcagcagtacagcttgttgaactccttagagcagcggaagattacgattct
ggcatgcggcttccaaagaactggatgcatcttcatttcctgcgtgctattggaactgca
atgtcaatgagagctggtatcgctgctgatacgtctgctgctttacttttccgaatactc
tcccaaccgacattactttttcctccactgagacatgccgaaggagttgaactccatcat
gagccactaggtggctatgtatcatcgtacaaaaggcagctggaagttcctgcatctgaa
gccactattgatgccactgcgcaaggcattgcttccatgctatgtgctcatggtcccgat
gttgagtggagaatatgtaccatctgggaggctgcgtatggtttgctacctctgagttca
tcagcagttgatttgcctgaaattgttgtagctgctccacttcagccacctactttgtca
tggagcctatacttgccattgttgaaagtatttgagtatttacctcgtgggagtccatct
gaagcatgccttatgagaatttttgtggcaacagttgaagctatactgagaagaactttt
ccatcagaaacctctgaacaatccaggaaaccaagaagtcaatctaagaaccttgctgtt
gctgaactccgaacaatgatacattcactctttgtggagtcctgtgcttcaatggacctt
gcgtccagattactatttgtagtattaactgtttgcgtcagtcatcaagctttgcctggg
ggaagtaaaaggccaactggtagtgataatcattcctctgaggaggtcacaaatgattcg
agattaaccaatggaagaaacagatgtaagaagagacaaggaccagttgctacattcgac
tcatacgttctagcagccgtttgtgccttatcttgtgagctccagctgttcccttttatt
tccaagaatgggaaccattcaaatctgaaggactccataaagatagtcatacctggaaaa
accactggtatcagtaacgagctacacaatagcattagctcagcgattcttcatactcgt
agaatacttggcatcttggaagctctgttctccttgaagccatcatctgttggtacttca
tggagttatagttcaaatgagattgttgcagcagctatggttgctgctcatgtttctgag
ttatttcgtcgatccaggccatgcttaaatgcactgtctgcgctgaagcaatgcaagtgg
gatgctgagatttctaccagggcatcatccctttaccatttgattgacttgcatggtaaa
acagtgacctccattgtgaacaaagctgagcctctagaagctcacctgacccttacacca
gtaaaaaaggatgaacctcccattgaggaaaagaacattaactcatcagatggtggtgca
ttggaaaaaaaggatgcttcaagatcacacaggaaaaatggttttgcaagaccactcttg
aaatgtgcagaagatgttatactaaatggtgatgtcgcaagtacttctgggaaagccatt
gcaagtttacaggtggaagcttctgatttggcaaacttcctcaccatggaccgaaatggg
ggttacagaggttctcaaactctcctaagatctgtactgtcagagaagcaggagctatgc
ttctctgttgtctcattgctctggcagaagctcattgcatctcccgaaatgcagatgtct
gcagaaagtacatcagctcatcagggttggagaaaggttgtggatgcgctttgtgacatt
gtttcagcctcaccgaccaaggcttcagctgctatcgttctgcaggccgagaaggacttg
cagccctggattgctcgagatgatgagcaaggtcagaagatgtggagagtcaaccagcga
atagttaagctgatagcagagcttatgaggaaccacgatagcccagaagcattggtgatc
cttgctagtgcttcagatcttcttcttcgagcaactgatggaatgcttgttgatggtgaa
gcttgtactttaccacaattagagctattggaagtaaccgccagagcagtccatctcatc
gtcgaatggggagattcaggtgtatccgtcgctgatggcctctccaatctgctgaagtgc
cgtctatcaaccaccatccgctgtctttcgcaccccagcgcgcatgtccgtgcactcagc
atgtccgtccttcgcgacatcttgaacagcggacaaataaactccagtaagctcatccaa
ggggaacaccggaatggcatccagagcccaacctaccagtgcttggcagcaagcatcatc
aactggcaagccgatgtggagagatgcatagagtgggaagcccacagccgccgcgccacc
gggctgacgctcgccttcctcaccgcggcggcgaaggagctcggctgcccactcacttgc
tga

DBGET integrated database retrieval system