KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325387
Entry
4325387           CDS       T01015                                 
Name
(RefSeq) cell division protein FtsY homolog, chloroplastic
  KO
K03110  fused signal recognition particle receptor
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03060  Protein export
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    4325387
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:osa02044]
    4325387
Secretion system [BR:osa02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   4325387
SSDB
Motif
Pfam: SRP54 SRP54_N YqeC AAA_30 AAA_17 AAA_28 AAA_22 CbiA HerA_C AAA_31 MobB Zeta_toxin AAA_27 DUF2075 ABC_tran VirC1 APS_kinase AAA_16 Ploopntkinase3
Other DBs
NCBI-GeneID: 4325387
NCBI-ProteinID: XP_015629030
UniProt: Q5JK67 A0A8J8XWJ3
LinkDB
Position
1:complement(42234590..42237451)
AA seq 363 aa
MAAHSHVIPFLSPAATSARCSPYGHRRRGRAGLLRCAAAAGQAGFFTRLGRLIQEKAKSD
VEKLFSGFSKTRESLSVVDELLTYWNLADTDRVLDELEEALLVSDFGPKISFRIVDTLRE
EIRDGKLKSGAEIKEALKRCILELLTSKGGNPELQLGFRKPAVIMIVGVNGGGKTTSLGK
LAYRFKNEGVKVLMAAGDTFRAAARDQLEVWAERTGSEIVIDNDKKAKPASVLSQAVKRG
KREGFDLVLCDTSGRLHTNYGLMEELVSCKKVIAKALPGAPNEILLVLDGTTGLNMLQQA
REFNDVVGVTGFVLTKLDGTARGGCVVSVVDELGIPVKFIGVGEGMEDLQPFDAEAFVEA
IFP
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggcggcacactcccacgtcatccccttcctctccccggcggcgacgtccgcgcgctgc
tccccctacggccaccgccgccgcggccgcgcggggctcctgcggtgcgcggcggcggcg
gggcaggcggggttcttcacccgcctgggacgcctcatccaggagaaggccaagagcgac
gtcgagaagctcttctccggcttctccaagacccgcgagagcctctccgtcgtcgacgag
ctcctcacctactggaacctcgccgacaccgaccgcgtcctcgacgagctcgaggaggct
ctgctggtgtcggattttggccccaagatttcgttccggatcgtggacactctacgcgag
gaaatccgcgatggcaagctcaagtctggggctgagataaaggaagcgctgaaaaggtgt
attcttgaactgctgacgagcaaaggcggcaatccggagctgcagctcggtttcagaaag
ccggcagttatcatgattgtgggagtgaatggaggtggaaagactacctcattaggaaaa
cttgcttacagattcaagaatgaaggagtgaaggtattgatggcagcaggtgataccttc
agagcagcagctcgtgaccagctagaagtttgggcagagagaacaggttcagagattgtt
atcgataatgataagaaagcaaaacctgcatcagttctctcgcaggcagtgaagcgcggg
aagcgtgaaggatttgatcttgttctttgcgacacgtcaggacgacttcatacaaattat
ggtctgatggaagaattggtttcctgcaagaaagtcatagctaaagcccttccgggtgct
cctaatgagatcttgctggttctggatggcacgactggcttgaatatgctacaacaagcg
agggagttcaatgatgttgttggagtcacaggattcgtcctaacaaagcttgatggaact
gctcgtggtggttgtgtggttagcgttgtagatgaacttggaattccagtaaagtttatt
ggtgttggtgaagggatggaggatcttcagccttttgatgctgaggcatttgttgaagcc
atttttccttga

DBGET integrated database retrieval system