KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325393
Entry
4325393           CDS       T01015                                 
Name
(RefSeq) DNA mismatch repair protein MLH1 isoform X1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    4325393
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:osa03400]
    4325393
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     4325393
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 4325393
NCBI-ProteinID: XP_015649867
UniProt: A0A0P0VD29 Q5JN46
LinkDB
Position
1:42268885..42274905
AA seq 724 aa
MDEPSPRGGGCAGEPPRIRRLEESVVNRIAAGEVIQRPSSAVKELIENSLDAGASSVSVA
VKDGGLKLIQVSDDGHGIRFEDLAILCERHTTSKLSAYEDLQTIKSMGFRGEALASMTYV
GHVTVTTITEGQLHGYRVSYRDGVMENEPKPCAAVKGTQVMVENLFYNMVARKKTLQNSN
DDYPKIVDFISRFAVHHINVTFSCRKHGANRADVHSASTSSRLDAIRSVYGASVVRDLIE
IKVSYEDAADSIFKMDGYISNANYVAKKITMILFINDRLVDCTALKRAIEFVYSATLPQA
SKPFIYMSIHLPSEHVDVNIHPTKKEVSLLNQERIIETIRNAIEEKLMNSNTTRIFQTQA
LNLSGIAQANPQKDKVSEASMGSGTKSQKIPVSQMVRTDPRNPSGRLHTYWHGQSSNLEK
KFDLVSVRNVVRSRRNQKDAGDLSSRHELLVEIDSSFHPGLLDIVKNCTYVGLADEAFAL
IQHNTRLYLVNVVNISKELMYQQALCRFGNFNAIQLSEPAPLQELLVMALKDDELMSDEK
DDEKLEIAEVNTEILKENAEMINEYFSIHIDQDGKLTRLPVVLDQYTPDMDRLPEFVLAL
GNDVTWDDEKECFRTVASAVGNFYALHPPILPNPSGNGIHLYKKNRDSMADEHAENDLIS
DENDVDQELLAEAEAAWAQREWTIQHVLFPSMRLFLKPPKSMATDGTFVQVASLEKLYKI
FERC
NT seq 2175 nt   +upstreamnt  +downstreamnt
atggacgagccttcgccgcgcggaggtgggtgcgccggggagccgccccgcatccggagg
ttggaggagtcggtggtgaaccgcatcgcggcgggggaggtgatccagcggccgtcgtcg
gcggtgaaggagctcatcgagaacagcctcgacgctggcgcctccagcgtctccgttgcg
gtgaaggacggtggcctcaagctcatccaggtctccgatgacggccatggcatcaggttt
gaggatttggcaatattgtgcgaaaggcatactacctcaaagttatctgcatacgaggat
ctgcagaccataaaatcgatggggttcagaggggaggctttggctagtatgacttatgtt
ggccatgttaccgtgacaacgataacagaaggccaattgcacggctacagggtttcttac
agagatggtgtaatggagaatgagcctaagccttgcgctgcggtgaaaggaactcaagtc
atggttgaaaatctattttacaacatggtagcccgcaagaaaacattgcagaactccaat
gatgactaccccaagatcgtagacttcatcagtcggtttgcagtccatcacatcaacgtt
accttctcttgcagaaagcatggagccaatagagcagatgttcatagtgcaagtacatcc
tcaaggttagatgctatcaggagtgtctatggggcttctgtcgttcgtgatctcatagaa
ataaaggtttcatatgaggatgctgcagattcaatcttcaagatggatggttacatctca
aatgcaaattatgtggcaaagaagattacaatgattcttttcataaatgataggcttgta
gactgtactgctttgaaaagagctattgaatttgtgtactctgcaacattgcctcaagca
tccaaacctttcatatacatgtccatacatcttccatcagaacacgtggatgttaatata
cacccaaccaagaaagaggttagccttttgaatcaagagcgtattattgaaacaataaga
aatgctattgaggaaaaactgatgaattctaatacaaccaggatattccaaactcaggca
ttaaacttatcagggattgctcaagctaacccacaaaaggataaggtttctgaggccagt
atgggttctggaacaaaatctcaaaaaattcctgtgagccaaatggtcagaacagatcca
cgcaatccatctggaagattgcacacctactggcacgggcaatcttcaaatcttgaaaag
aaatttgatcttgtatctgtaagaaatgttgtaagatcaaggagaaaccaaaaagatgct
ggtgatttgtcaagccgtcatgagctccttgtggaaatagattctagcttccatcctggc
cttttggacattgtcaagaactgcacatatgttggacttgccgatgaagcctttgctttg
atacaacacaatacccgcttataccttgtaaatgtggtaaatattagtaaagaacttatg
taccagcaagctttgtgccgttttgggaacttcaatgctattcagctcagtgaaccagct
ccacttcaggagttgctggtgatggcactgaaagacgatgaattgatgagtgatgaaaag
gatgatgagaaactggagattgcagaagtaaacactgagatactaaaagaaaatgctgag
atgattaatgagtacttttctattcacattgatcaagatggcaaattgacaagacttcct
gttgtactggaccagtacacccctgatatggaccgtcttccagaatttgtgttggcttta
ggaaatgatgttacttgggatgacgagaaagagtgcttcagaacagtagcttctgctgta
ggaaacttctatgcacttcatcccccaatccttccaaatccatctgggaatggcattcat
ttatacaagaaaaatagagattcaatggctgatgaacatgctgagaatgatctaatatca
gatgaaaatgacgttgatcaagaacttcttgcggaagcagaagcagcatgggcccaacgt
gagtggaccattcagcatgtcttgtttccatccatgcgacttttcctcaagcccccgaag
tcaatggcaacagatggaacgtttgtgcaggttgcttccttggagaaactctacaagatt
tttgaaaggtgttag

DBGET integrated database retrieval system