KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325482
Entry
4325482           CDS       T01015                                 
Name
(RefSeq) protein DAMAGED DNA-BINDING 2
  KO
K10140  DNA damage-binding protein 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03420  Nucleotide excision repair
osa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4325482
  09124 Replication and repair
   03420 Nucleotide excision repair
    4325482
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:osa04121]
    4325482
   03400 DNA repair and recombination proteins [BR:osa03400]
    4325482
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     4325482
DNA repair and recombination proteins [BR:osa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      4325482
SSDB
Motif
Pfam: WD40 PQQ_3
Other DBs
NCBI-GeneID: 4325482
NCBI-ProteinID: XP_015622245
UniProt: Q84KJ3
LinkDB
Position
1:complement(2250837..2255147)
AA seq 583 aa
MGPTTRARFVHNRRRRRRRGPYAAPDDDDEEEDQQEASSSSSSSDEGEEDAEEEGSGEVD
DDDGEAAEPSGKEEEVSPVAAAARSGRKASITISLKKVCKVCKSTGHEAGFKGAVYIDCP
RKPCFLCKMPGHTTLTCPHRVAMEHGVIPASRRNTNTSLDYVFQSQVKGKIPMVKPQFLI
PNQLECGNIKFHQRRVTCLEFHPTKNNVLLSGDKKGLLGVWDYVKLHEKITYDSVHSCIL
NSMKFDTTNDGLLYTASSDGTISSTDLDTGIGSSLLNLNPNGWNGPSTWRMIYGMDFNSD
KGLLLVADSFGFLHLLDRRLKARIGDPILIHKKGSKVTSLHCNPAQPEVLLSSGNDHYAR
IWDTRKLEPNSAFVSLAHGRVVNSGYFSPQSGNKILTTCQDNRIRVWDYIFGNLESPSRE
IVHSHDFNRHLTPFKAEWDPKDHTETVAVIGRYISENYNGIALHPIDFIDTSTGKLLAEV
MDPDITTISPVNKLHPRDDILASGSSRSIFIWKPKTESDATEERNREKAKEFVYGSGSRK
KSNGKHENSSDDDSDGSCDGKKKKKAKKTRFTHTIKGKGKSKV
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgggccctaccacccgcgcccgcttcgtccacaaccgccgccgccgccgccgccgcggg
ccgtacgccgcccccgacgacgacgacgaggaggaggaccagcaggaagcctcctcgtct
tcctcatcctccgacgagggagaggaggatgctgaggaggagggctccggagaagtcgat
gacgatgatggcgaagcggcggaaccctcgggtaaggaggaggaggtgtcccccgtggct
gcggcggcgaggagcgggaggaaggcctcgatcacaattagtctcaagaaagtgtgcaag
gtttgcaagagtacagggcatgaggccgggtttaagggagcagtgtatatcgattgcccc
aggaagccttgtttcctatgcaagatgccaggccatacaaccttgacatgcccacataga
gtagcaatggagcatggtgttatcccggcctctagaaggaacacaaacacttcactggat
tatgtgtttcagagccaagttaaaggcaagattcccatggttaagcctcagtttctgata
cccaatcaactggagtgtgggaacataaaatttcaccagaggcgtgtgacctgcttggaa
ttccatccaactaagaataatgtgcttttatcaggagacaagaaaggactattaggtgtt
tgggattacgtcaagttgcatgagaagattacttatgattctgtgcattcttgcattctc
aacagcatgaagtttgacactaccaatgatggattactatatacagcctcttctgatggt
actataagtagcacagacttggacactggaattggctcctctctgctgaatttaaatcca
aatggctggaatggtccgagcacttggcgcatgatttacgggatggactttaactctgac
aaaggtcttcttttggtggcggatagcttcggttttcttcacttgctggatagacggttg
aaggcaagaattggagatccaattcttatacataaaaagggtagcaaggttaccagcctc
cactgtaaccctgctcagcctgaagttcttctaagcagtggaaatgatcactatgcccgt
atttgggatacaaggaagctggagcccaactctgcctttgtgagccttgctcatggaaga
gttgttaattcaggatatttttccccacaaagtgggaataagatcttgacaacatgtcag
gataatcgaatccgtgtatgggattatatttttggtaatctggaatccccaagtagagag
attgttcacagccatgacttcaatcgtcacttgactcccttcaaagcagagtgggatcca
aaggatcacacagaaacagttgcagttattggtcgttacataagtgaaaactacaatggg
attgctctacatcccattgatttcatagacaccagtactgggaagcttctggctgaggtg
atggaccctgacattacaactatcagcccggtgaacaagctacatccgcgagatgatatc
ctggcttcaggaagttcaaggtccattttcatttggaaaccaaagactgaaagtgatgct
actgaagagaggaacagagagaaggcaaaggaatttgtatatggatcaggcagccggaaa
aaatcaaatggcaagcatgagaatagcagtgatgatgactcagatggcagttgtgatgga
aagaagaagaagaaagcgaagaagactcgcttcactcataccataaaggggaagggcaaa
tccaaggtttga

DBGET integrated database retrieval system