KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325536
Entry
4325536           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4325536
  KO
K10643  CCR4-NOT transcription complex subunit 4 [EC:2.3.2.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4325536
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4325536
   03019 Messenger RNA biogenesis [BR:osa03019]
    4325536
   04121 Ubiquitin system [BR:osa04121]
    4325536
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     4325536
Transcription factors [BR:osa03000]
 Eukaryotic type
  Zinc finger
   Cys3His zinc factors
    4325536
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4325536
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     4325536
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    4325536
SSDB
Motif
Pfam: zf-RING_4 RRM_1 Baculo_IE-1
Other DBs
NCBI-GeneID: 4325536
NCBI-ProteinID: XP_015632103
LinkDB
Position
1:complement(5945631..5954399)
AA seq 849 aa
MTTQAKEKCPLCTEEMDLTDKQLKPCKCGYEICLWCWHQIMEMDQKEECGGRCPACRSIY
NKDRIMGTSISNQILKELCADKSNFQKEQAKSQKQKPVKVQSGVTEESIDPYSVRVIQRR
LVYIVGMPSEFASDKVLRQHNFLGQYGKIESIIIDNIGANQQIPDSGRVYVTFSREEEAF
RCIEAVNGFILDGRPLKATFGVTRYCHVWLSNKVCRKPICSYVHQKAPPEDICTKDDVAV
YCARLQHLLGMDTKGLRSGNTLPPPGDCVSRTTVCNGNSKDKTCSDDYGVLHNHGNKNLG
TLPATTLQEEKKRNSTPNNQQGLSASVSQELPPLGPKVHHLNDQLASCGDKPQASVQSAN
GNLNSKQVTAAGNGTVGTLSAKQYVNVVSQGSSGSGRRFTVLTRQTASSDTRSKATGQVG
NASSDSQKLTSANNEHSDRIKISRSDNVKLVSQRPEEPSQMLANHLTGAIDKTHVDTDEK
NARSDINEKTVCGIQMQLKESTAAHRSTVLQSLRDNPMSNNLPTLDVKSQISVVPDKPSD
SQSASKTQLQPSNHKKTAVCSSDTANASDACGIANNQVLFPGGKHQTSSQGEDHSLYKRD
KSQSGDQLSSQHPGNVFSPRLLTSLSSIDITAKENKGIKRHVCPPGFEELHRPSDSDKIT
SVSSPTSSIMCSGPDTLVQDSCSAKDQPDFISWVSECLEDGGETTQSNRSIPSTLSSTDA
TWRYMQYPASCFSGASNHFLVSPYPRGLSQHTVGRIENTMNCCCSHPSVSGIANHKPEYW
SGSDHSYMSTGGYDVFSQSATLGMIAGMVGTSPQQPSPPVHYNDWTTGSADSDLKSPQVD
HTYPMYSLF
NT seq 2550 nt   +upstreamnt  +downstreamnt
atgacgacccaagctaaagaaaaatgcccactttgcacagaggagatggatttgacagat
aaacagctgaagccgtgtaaatgtggatatgagatttgtctttggtgttggcatcagata
atggaaatggatcagaaggaagaatgtggcgggagatgccccgcgtgtcgttctatctac
aacaaggacaggatcatgggaacaagcatcagcaaccaaatattaaaggaactttgtgct
gacaaatcaaactttcaaaaagaacaagccaagtctcaaaagcagaaaccagtaaaagtt
cagtcaggagtgacagaagaatcaatagacccatatagtgttcgtgtgattcaacgcagg
cttgtttatattgttgggatgccttctgaattcgcgagtgacaaggtgctgaggcagcat
aattttcttgggcaatatggaaaaatagaaagtattattatcgacaatattggagctaac
caacagattcctgactctggccgtgtatatgttaccttttcaagggaggaagaagctttt
cggtgcattgaggcagttaatggtttcatcttggatggtagacctctaaaggcaactttt
ggcgttacaagatattgtcatgtatggctaagcaataaggtttgccgaaagccaatctgt
tcgtacgtgcatcaaaaagccccaccagaagatatttgtacgaaggacgatgtcgctgtg
tactgtgcaaggcttcagcatttgttgggaatggatacaaagggtctccgttcaggaaat
actttgccccctcctggtgactgtgtatcaagaactaccgtttgtaatggaaactccaaa
gataagacctgcagcgatgattatggagtactacacaatcacggtaacaagaatcttggc
acgctgccagctacaactcttcaagaagagaagaaacgtaatagcacacctaataatcag
caaggattgtctgcctccgtgtctcaggaattaccaccgcttggaccaaaggttcaccat
ctcaatgatcagttggcttcctgtggtgataagccccaagcatctgtgcagtcagcaaat
ggcaatttgaattctaagcaagtaactgcagcaggaaatggaacggtgggcaccttatca
gcaaaacaatatgttaatgtagtttcacaaggatcaagtggttcaggtcgcagatttact
gtacttactaggcagacggcttctagtgatactcggtctaaagcaacaggacaagtcggt
aatgcctcttcagattcccagaagcttacttcggcaaacaatgagcacagtgacagaatt
aaaatttctaggagtgataatgtaaagttagtttcgcagagaccagaggaaccttcccaa
atgctagctaatcatttgaccggagcaattgataagacccacgttgatacagatgaaaag
aatgctcgctcagatataaatgaaaaaacagtttgtggtattcagatgcagcttaaagaa
agcactgcagcacacagatcaactgtgctgcagagtttgagggacaatcctatgtccaat
aatcttccaacattggatgtcaaatctcagatatcagttgtgccagacaagccttcagat
tcacagtcagcatctaaaactcaattgcagccctcaaatcataaaaaaactgctgtttgt
agttcagatacagccaatgcaagtgatgcatgtggcatcgctaataatcaggtgctgttc
cctggtggtaaacatcaaacttcatcacaaggggaggatcacagcttgtacaagagggat
aagagtcagtcaggagatcaactttcatctcagcatcctgggaatgttttctcaccaaga
ctactcacttcactgtcatccattgatataactgccaaggaaaataaaggaattaaaagg
cacgtttgtcctcctggatttgaggagcttcacaggccgtctgattctgacaagattaca
tcagtaagctccccaacttcttctattatgtgctctggacctgataccctggtacaagat
tcatgctctgctaaagatcagccagacttcattagctgggtttcagagtgcctagaagat
ggtggagaaactacacaaagtaataggagcataccttctactctcagttccacagatgcc
acttggagatacatgcagtatcctgcctcctgtttttctggtgcatcaaatcactttcta
gtatcaccgtaccctagaggattgtcacagcacacggtgggtcggattgaaaataccatg
aattgctgctgttcccatccatctgtcagtggcatagcaaatcacaagcctgaatactgg
agtggaagtgaccatagctacatgtctactgggggatatgatgtattcagtcaaagtgca
acattaggcatgatagctggtatggtaggcacatcgccccaacaaccttcgccacctgtt
cattacaatgactggaccacgggaagtgctgattcagatttgaagagtccacaggttgat
catacataccccatgtactcgctgttctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4349535
Entry
4349535           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4349535
  KO
K10643  CCR4-NOT transcription complex subunit 4 [EC:2.3.2.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4349535
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4349535
   03019 Messenger RNA biogenesis [BR:osa03019]
    4349535
   04121 Ubiquitin system [BR:osa04121]
    4349535
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     4349535
Transcription factors [BR:osa03000]
 Eukaryotic type
  Zinc finger
   Cys3His zinc factors
    4349535
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4349535
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     4349535
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    4349535
SSDB
Motif
Pfam: zf-RING_4 RRM_1 Baculo_IE-1 zf-RING_2 PcfJ zf-UDP
Other DBs
NCBI-GeneID: 4349535
NCBI-ProteinID: XP_015616958
LinkDB
Position
11:110147..116980
AA seq 1097 aa
MMTMSDDGDRTCPLCAEDMDITDQQLKPCKCGYEICVWCWHHIIDMAEKEDTEGRCPACR
TRYDKDRIVKMAATCDRTVVEKNVDKKQKTQKVKSKAAVTVEAKKHLASVRVIQRNLVYI
IGLPANLCNESILERREYFGQYGKVLKVSVSRPTGAPSQQAPTNNSISVYITYAKEEEAI
RCIQAVHNFVLEGKVLRACFGTTKYCHAWLRNMTCGNPDCLYLHDVGSQEDSFTKDEIIS
AYTRSRVPQMASSVSQRRAGTVLPPPAEDFSYSAVVAAKHPIKNGITNTANQSRLSPPNS
SSGRSTLPPAASWGHRDLNTRTTATGVASSQSLTKSKTDPQSNSFSSSSTVSSTKLPSSW
NDDTSTVPKMMEGRDSLSKTLKPYKPGIAKETQAVTSLESSLDIDFSTIPSAWNDDDVTS
DGMSKGSDEKQVVNDNGKFECSVSSKPAESGHLTSKSTTSPKKDIAVNSTRQSPLNCVSS
PSISKSEVKDGDGDYQVTNMASKTSTSVIRKDQSNQAAIDTATEDTRSESTDIDRLSVGV
SSVTLSRKDGVQSIAENQQPDAILSTSVVVPFSQNLKLADSNDSTCQPSSDKHHDWCSDI
QSSVSPQLNDIESYAVATDKSHGRVLDAADQASSSPYVHFPNTSPISLWNGKEINHTSTS
DRTSTMMQPGLLSSVDSTSTMLNGHQEGLGTIYAPGKVSEHPRMKNHQPGAVGAVRIDNI
GSFDKAVSVNKDESSIIADILSLEFDPWDESYSTANNFAKMLSASEKNDVLFDAPSWKTK
TSNSESRFSFARQDNQGSFLDSSMRNYKSEQNFSLLSQNSHGNIYQSGIAFQSPEEGFAK
SNSLTMLDMLATGTSKPKVSAPPGFSAPARVPPGFSSGFSSHEGLNPPPGFSSHNGPNPP
PGFSSQGGSNQIYGSAYSETRPFDYLLGINTSHYQPQLARQTSDIEFVDPAILAVGKGRM
PGISDSGLEMKTSHTFPSQLQTSNDPRFQLLMQQNVPSHQNVGFAEHVQDAFNPMNDNYL
ASRLIPQNHGSLSSYTQMSLQQPRSSHLTNGHWDGWGDLRQGNNVSMPDMSRMLYPTEAN
NFHMLGSNDLYNRAFGL
NT seq 3294 nt   +upstreamnt  +downstreamnt
atgatgaccatgagcgacgatggagaccgcacctgcccgctctgtgctgaggacatggat
atcactgaccagcagctcaagccctgcaaatgcggctatgagatttgtgtctggtgctgg
caccacatcattgatatggctgagaaagaggacactgagggccgctgccccgcatgccgc
actcgctatgacaaagataggattgtcaagatggctgccacttgtgacaggacggtagtg
gagaagaatgtggacaagaaacagaagacccaaaaggtcaagtcaaaggccgcggtaact
gtggaagctaagaaacatcttgctagcgtcagggttatccagagaaacctcgtgtacata
attggactacctgcaaatttatgcaacgaaagcatacttgagcgcagggaatactttggt
cagtatggcaaggttctgaaagtttcagtttctcggccgactggggctccttcccagcag
gcaccaacaaacaacagtatcagcgtatatattacatatgccaaagaagaagaggccatc
aggtgtattcaagctgtacacaattttgttttggaagggaaagtgttaagagcgtgcttt
ggtactacaaagtattgccatgcatggctgcggaacatgacctgtggaaatccagattgt
ctctatttacatgatgtaggaagccaggaagatagtttcactaaagatgagataatctca
gcatatacaaggagtagggttccccaaatggcgtctagtgtttctcaaagacgcgcaggg
actgtattacctcctccagcagaagatttctcatatagtgcagtggttgcagctaaacat
ccaatcaagaatggaataactaatactgcaaatcaatccaggctttcgcctccaaacagt
agttctgggagatccacacttccaccagctgcttcatgggggcatcgcgatttgaatacc
aggacaacagcaactggggtggcatcgtcacaatctcttactaaatcaaaaacagatcct
caaagtaattcattctcaagttcttcgactgtttcaagtacaaaactaccttcttcatgg
aatgatgacacaagcacagttccgaaaatgatggaaggacgagatagtttgtctaaaacc
ttgaagccatataagcctggtattgcaaaggaaacccaagctgtaacatcactggagtca
tcgcttgacatagacttctctaccataccttcagcttggaacgatgatgatgtcacatca
gatggcatgtcaaaaggaagtgatgagaagcaggttgtaaatgacaatggaaagtttgaa
tgttcagtttcttcaaagccagctgaatcagggcatcttacatcgaagtcaacgacatca
ccaaagaaagacatcgcagtaaacagtaccaggcaaagtcctctaaattgtgtatcaagt
ccatcgatttctaaatcagaagtaaaggatggtgatggtgattaccaagtaaccaacatg
gcttctaaaacatctacttcggtaattagaaaggaccaatctaatcaagcagctattgac
acagcaaccgaagatactagatctgagagcacggatattgataggctgtctgttggagta
tcttcagtaacattaagcagaaaagatggggttcaaagtattgccgaaaaccaacaaccg
gatgcaatcctaagtacttcagttgtggtgccctttagtcagaatttgaaacttgctgac
agtaatgattctacatgtcagcctagttcagataagcatcatgattggtgttcagatatc
cagagtagtgtgtctcctcagttaaatgacatagaaagttatgcagtagccactgataaa
tctcatggtagagtgctggatgctgctgatcaagcttcgtcttcaccatatgtccatttc
cctaacacgtctcctatttcactgtggaatggtaaagaaattaaccatacatcaacaagt
gatagaacttccacaatgatgcaacctgggctgttatcttcagttgacagcacttctacc
atgttaaatggacatcaagaagggctagggactatatatgcacctggtaaggtttctgaa
catcctagaatgaaaaaccatcagcctggagcagttggtgcagtgagaattgataacata
ggcagttttgacaaggctgtaagtgtaaataaggatgagagcagcataattgctgatatt
ttgtctttggagtttgatccatgggatgagtcatattcaacggctaacaattttgctaag
atgcttagtgcatctgaaaagaacgatgtgctttttgatgcaccttcatggaaaacaaaa
accagcaatagtgagtctagattttcatttgctagacaagataatcaaggaagcttccta
gattcatctatgagaaattataaaagtgagcagaatttcagtttgctatcccagaattct
catggaaacatttatcagagtggcattgcatttcaatctcctgaggaaggtttcgcaaag
agcaactctcttactatgttggatatgctagctaccggcacatcaaagcctaaagtatcc
gcgcctcctggattttcagcaccagcaagagttcctcctgggttttcttctggattttca
tcccatgaggggttgaatccacctccaggattttcatctcataatgggcctaatccccct
cctggattttcttctcagggtgggtctaatcagatctatggttcggcatactcagaaact
cgcccatttgattatcttttgggtataaatactagccattatcaaccacagttagctaga
caaacaagtgatatagaatttgttgatcctgctatattggctgtgggtaaagggcggatg
cctggaataagtgattcagggttggagatgaaaacttcccatacttttccttcgcagttg
caaacatcaaatgatccaaggtttcaattacttatgcagcagaacgtgccttcccatcaa
aatgttggatttgcagaacatgttcaagatgcattcaaccctatgaatgataattatctt
gcatcccgacttatacctcagaaccatggttctctatcctcttacacacagatgtcactc
caacaacctagaagctcacatcttacaaatggtcattgggatggctggggtgatttgaga
caagggaataatgtttccatgcctgacatgtcaaggatgttatatccaactgaagcaaac
aacttccacatgctgggttcaaatgatctgtataacagagcttttggactgtga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4351244
Entry
4351244           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4351244 isoform X1
  KO
K10643  CCR4-NOT transcription complex subunit 4 [EC:2.3.2.27]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4351244
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:osa03000]
    4351244
   03019 Messenger RNA biogenesis [BR:osa03019]
    4351244
   04121 Ubiquitin system [BR:osa04121]
    4351244
Enzymes [BR:osa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     4351244
Transcription factors [BR:osa03000]
 Eukaryotic type
  Zinc finger
   Cys3His zinc factors
    4351244
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4351244
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     4351244
Ubiquitin system [BR:osa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    4351244
SSDB
Motif
Pfam: zf-RING_4 RRM_1 Baculo_IE-1 zf-RING_2 PcfJ zf-UDP
Other DBs
NCBI-GeneID: 4351244
NCBI-ProteinID: XP_015619668
UniProt: Q2QYY3 Q0IQS9
LinkDB
Position
12:105883..112650
AA seq 1097 aa
MMTMSDDGDRTCPLCAEDMDITDQQLKPCKCGYEICVWCWHHIIDMAEKEDTEGRCPACR
TRYDKDRIVKMAATCDRTVVEKNVDKKQKTQKVKSKAAVTVEAKKHLASVRVIQRNLVYI
IGLPANLCNESILERREYFGQYGKVLKVSVSRPTGAPSQQAPTNNSISVYITYAKEEEAI
RCIQAVHNFVLEGKVLRACFGTTKYCHAWLRNMTCGNPDCLYLHDVGSQEDSFTKDEIIS
AYTRSRVPQMASNVSQRRAGTVLPPPAEDFSYSAVVAAKHPIKNGITNTANQSRLSPPNS
SSGRSTLPPAASWGHRDLNTRTTATGVASSQSLTKSKADPQSNSFSSSSTVSSTKLPSSW
NDDTSTVPKMTEGRDSLSKTLKPYKPGIAKETQAVTSLESSLDIDFSTIPSAWNDDDVTS
DGMSKGSDEKQVVNDNGKFECSVSSKPAESGHLTSKSTTSPKKDIAVNSTRQSPLNCVSS
PSVSKSEVKDGDGDYQVTNMASKTSTLVIRKDQSNQAAIDTATEDTRSESTDIDRLSVGV
SSVTLSRKDGVQSIAENQQPDAILSTSVVVPFSQNLKLAECNDSTCQPSSDKHRDWCSDI
QSSVSPQLNDIESYAVATDKSHGRVLDAADQASSSPYVHFPNTAPISLWNGKEINHTSTS
DRTSTMMQPGLLSSVDSTSTMLNGHQEGLGTIYAPGKVSEHPRMKNHQPGAVGAVRIDNI
GSFDKAVSVNKDESSIIADILSLEFDPWDESYSTANNFAKMLSASEKNDVLFDARSWKTK
TSNSESRFSFARQDNQGSLLDSSMRNYKSEQNFSLPSQNSHGNIYQSGIAFQSPEEGFSK
SNSLTMLDMLATGTSKPKVSAPPGFSAPARVPTGFSSGFSSHEGLNPPPGFSSHNGPNPP
PGFSSQGGSNQIYGSAYSETRPFDDLLGINTSHYQPQLARQTSDIEFVDPAILAVGKGRM
PGISDSGLEMKTSHTFPSQLQTSNDPRFQLLMQQNMPSHQNVGFAEHVQDAFNPMNDNYL
ASRLIPQNHGSLSSYTQMSLQQPRSSHLTNGHWDGWGDLRQGNNVSMPDMSRMLYPTEAN
NFHMLGSNDLYNRAFGL
NT seq 3294 nt   +upstreamnt  +downstreamnt
atgatgaccatgagcgacgatggagaccgcacctgcccgctctgtgctgaggacatggac
atcactgaccagcagctcaagccctgcaaatgcggctatgagatttgtgtctggtgctgg
caccacatcattgatatggctgagaaagaggacactgagggccgctgccccgcatgccgc
actcgctatgacaaagataggattgtcaagatggctgccacttgtgacaggacggtagtg
gagaaaaatgtggacaagaaacagaagacccaaaaggtcaagtcaaaggccgcggtaact
gtggaagctaagaaacatcttgctagcgtcagggttatccagagaaacctcgtgtacata
attggactacctgcaaatttatgcaacgaaagcatacttgagcgcagggaatactttggt
cagtatggcaaggttctgaaagtttcagtttctcggccgactggggctccttcccagcag
gcaccaacaaacaacagtatcagcgtatatattacatatgccaaagaagaagaggccatc
aggtgtattcaagctgtacacaattttgttttggaagggaaagtgttaagagcgtgcttt
ggtactacaaagtattgccatgcatggctgcggaacatgacctgtggaaatccagattgt
ctctatttacatgatgtaggaagccaggaagatagtttcactaaagatgagataatctca
gcatatacaaggagtagggttccccaaatggcgtctaatgtttctcaaagacgcgcaggg
actgtattacctcctccagcagaagatttctcatatagtgcagtggttgcagctaaacat
ccaatcaagaatggaataactaatactgcaaatcaatccaggctttcgcctccaaacagt
agttctgggagatccacacttccaccagctgcttcatgggggcatcgcgatttgaatacc
aggacaacagcaactggggtggcatcgtcacaatctcttactaaatcaaaagcagatcct
caaagtaattcattctcgagttcttcgactgtttcaagtacaaaactaccttcttcatgg
aatgatgacacaagcacagttccgaaaatgacggaaggacgagatagtttgtctaaaacc
ttgaagccatataagcctggtattgcaaaggaaacccaagctgtaacatcactggagtca
tcgcttgacatagacttctctaccataccttcagcttggaacgatgatgatgtcacatca
gatggcatgtcaaaaggaagtgacgagaagcaggttgtaaatgacaatggaaagtttgaa
tgttcagtttcttcaaagccagctgaatcagggcatcttacatcgaagtcaacgacatca
ccaaagaaagacatcgcagtaaacagtaccaggcaaagtcctctaaattgtgtatcaagt
ccatcggtttctaaatcagaagtaaaggatggtgatggtgattaccaagtaaccaacatg
gcttctaaaacatctactttggtaattagaaaggaccaatctaatcaagcagctattgac
acagcaaccgaagatactagatctgagagcacggatattgataggctttctgttggagta
tcttcagtaacattaagcagaaaagatggggttcaaagtattgccgaaaaccaacaaccg
gatgcaatcctaagtacttcagttgtggtgccctttagtcagaatttgaaacttgctgag
tgtaatgattctacatgtcagcctagttcagataagcatcgtgattggtgttcagatatc
cagagtagtgtgtctcctcagttaaatgacatagaaagttatgcagtagccactgataaa
tctcatggtagagtgctggatgctgctgatcaagcttcgtcttcaccatatgtccatttc
cctaacactgctcctatttcactgtggaatggtaaagagattaaccatacatcaacaagt
gatagaacttccacaatgatgcaacctgggctgttatcttcagttgacagcacttctacc
atgttaaatggacatcaagaagggctagggactatatatgcacctggtaaggtttctgaa
catcctagaatgaaaaaccatcagcctggagcagttggtgcagtgagaattgataacata
ggcagttttgacaaggctgtaagtgtaaataaggatgagagcagcataattgctgatatt
ttgtctttggagtttgatccatgggatgagtcgtattcaacggctaacaattttgctaag
atgcttagtgcatctgaaaagaacgatgtgctttttgatgcacgttcatggaaaacaaaa
accagcaatagtgagtctagattttcatttgctagacaagataatcaaggaagcctccta
gattcatctatgagaaattataaaagtgagcagaatttcagtttgccatcccagaattct
catggaaacatttatcagagtggcattgcatttcaatctcctgaggaaggtttctcaaag
agcaactctcttactatgttggatatgctagctaccggcacatcaaagcctaaagtatcc
gcgcctcctggattttcagcaccagcaagagttcctactgggttttcttctggattttca
tcccatgaggggttgaatccacctccaggattttcatctcataatgggcctaatccccct
cctggattttcttctcagggtgggtctaatcagatctatggttcggcatactcagaaact
cgcccatttgatgatcttttgggtataaatactagccattatcaaccacagttagctaga
caaacaagtgatatagaatttgttgatcctgctatattggctgtgggtaaagggcggatg
cctggaataagtgattcagggttggagatgaaaacttcccatacttttccttcgcagttg
caaacatcaaatgatccaaggtttcaattacttatgcagcagaacatgccttcccatcaa
aatgttggatttgcagaacatgttcaagatgcattcaaccctatgaatgataattatctt
gcatcccgacttatacctcagaaccatggttctctatcctcttacacacagatgtcactc
caacaacctagaagctcacatcttacaaatggtcattgggatggctggggtgatttgaga
caagggaataatgtttccatgcctgacatgtcaaggatgttatatccaactgaagcaaac
aacttccacatgctgggttcaaatgatctgtataacagagcttttggactgtga

DBGET integrated database retrieval system