KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325594
Entry
4325594           CDS       T01015                                 
Name
(RefSeq) uncharacterized protein LOC4325594 isoform X1
  KO
K12617  DNA topoisomerase 2-associated protein PAT1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4325594
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4325594
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4325594
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     4325594
SSDB
Motif
Pfam: PAT1
Other DBs
NCBI-GeneID: 4325594
NCBI-ProteinID: XP_015616802
UniProt: A0A5S6RD65 Q5ZAQ3
LinkDB
Position
1:32432973..32439528
AA seq 809 aa
MRGVESGGGGGGASSSSPAAAGNFDAGQYAFFGKEPLEGLELSCLEDGGGDGNGGGFSGP
EDGLYRLSSVGEEIDNLSNLSEIDDLASTFAKLNRSISGTRNPGVIGDRRSISRGSSLTV
DWAEDAEFPNWVDQDILEGEELQESKRWWSQSRSLGQQGDAKPLSRTSSYPQQPLQHRAS
EPIIAPQSPPFTSFPPPGARSPYTAQGLTRHGSIPSVGAGLQMGSPSMSLPSSSYHMAGL
SHGLPYGGSVSFGSPNLPGSNPIQNDWPNQANPYAVDQFNLLPNMLQKQISLPNSPMSSL
LFSQQQQRLAQVQVQPSHQNYLNLPPHLFYQHHSPELTGRFDSISNVPSLRDKRSRSGRG
KHSTRFSQPLTDTGSQNGDSGGLKFRSKYMSSEEIESILRMQHSASHSSDPYVVDYYHQA
CIAKKGASSRQKANFAPTSMKDLPSKSRSSSDHHAYLQVDALGRVSFSSIRRPRSLLEVD
LPSSGDGSHDQKSSLRPLEKEPMLAARVTVEDAICLLLEVDDIDRLLQSSQAQDNSFQLR
RRRQVLLEGLATSLQLVDPLGPSKSSHSSGLAPKDDLVFLRIVSLPKGRKLLSRYLRLLT
PGSELTRIICMAIFRHLRYLFGGLPSDSSAAETTVALAKTVSSCVLHMELGALSACLAAV
VCSSEQPPLRPLASSAGDGASLIIKSVLDRATELLTDHHAAASYTVSNRTLWQASFDAFF
GLLTKYCLSKYESIKQMFVMQSPCSVTGSEVSKATSREMPVELLRASLPHTNDQQRQLLL
DFAQRTMPVTGINPTGANGGYITSESVPG
NT seq 2430 nt   +upstreamnt  +downstreamnt
atgcggggtgtcgagtcgggtggcggaggcggcggcgcgtcttcttcctcccccgccgcc
gcaggtaattttgatgctgggcagtacgccttcttcgggaaggagccactggagggactc
gagctcagttgcttggaggatggcggcggtgatggcaatggcggtggattcagcgggcca
gaagatgggctgtaccggctctcttctgttggagaagagattgataatctgagtaacttg
tcagaaattgatgatcttgcgagcacttttgcaaagttgaaccgaagcattagtggaaca
cggaatcctggtgttattggtgacagaagatccatctcaagaggaagttctctaactgtt
gattgggctgaagatgctgagtttcccaactgggtagatcaagacatattagagggtgag
gaacttcaggaaagtaaaagatggtggtcacagtcacgttctctggggcagcaaggggat
gccaaaccattgagccgaacatcttcatatcctcaacaaccattgcagcaccgcgcaagt
gaacctatcattgcaccacaatctcctccatttacatcctttccacctccaggtgctaga
tcaccttatactgctcaaggccttacacgtcatgggagcattccatcagttggtgctggt
ctacaaatgggttctccaagcatgtcacttccaagttcttcatatcatatggctggacta
tctcatggactaccatatggagggagcgtgtcctttggttctccaaatcttcctggaagc
aatccaatacaaaatgattggccaaaccaagccaacccgtatgctgtggatcaatttaat
ctacttccgaacatgttacagaaacaaatatcacttccaaatagcccaatgtcatcactg
ctattttctcaacagcagcagagattggcacaagttcaagtccagccatcccatcagaat
tacctaaatttaccacctcacctattttaccaacatcactccccagagttaacaggaagg
tttgattctatcagcaatgttccttcattgagagacaagaggtcaaggtcaggaagggga
aaacacagcacacgtttttctcaaccattgactgatactggtagtcaaaatggtgatagt
ggtggactaaaattcaggtctaagtacatgtcatctgaagagatcgaatctatcttaaga
atgcagcattcagcaagtcacagcagtgatccttatgtagttgattattaccatcaagct
tgcatagcaaaaaagggtgccagttccaggcaaaaggccaattttgccccaacatcaatg
aaagacttaccttccaagtccagatctagcagtgaccatcatgcatatcttcaggttgat
gctctagggagggtttctttctcttccatacgtaggcctcggtctcttcttgaagttgac
cttccttcatctggtgatggttctcatgatcagaagtcttctctgaggcccctggagaaa
gaaccaatgctggcagctagagtcactgttgaagatgccatctgcctacttcttgaggtg
gatgatattgaccgtctattgcagtctagccaggcacaagataacagtttccaactgagg
cgaagacggcaggtcctccttgaaggtctagctacatcacttcagcttgttgaccctctt
ggtccgagcaaatcaagccattcatctggattggcccctaaggatgatcttgtttttctt
cggattgtttctcttcctaaaggacgcaaacttttgtcacggtaccttcgacttcttacc
cctggaagcgagttgacccgtataatatgcatggctatttttcgacatctgaggtacttg
tttgggggtttaccatcagattctagtgcagcagaaacaacagttgctcttgcaaagact
gtttcatcttgtgtgctccatatggaactaggtgctcttagtgcttgccttgctgctgtc
gtatgttcatctgagcagccacctctgcgtcctcttgctagctctgctggtgatggggct
tctcttattattaaatcagtactggaccgagcaaccgagttgctgactgaccaccatgct
gcagccagctatacagtgtcaaaccgaactctctggcaggcatcatttgatgctttcttt
ggactcctgacaaaatactgcctcagtaagtatgaaagtattaagcagatgtttgtcatg
cagtcaccatgctctgtaactggatctgaagtctcgaaagcaaccagcagggagatgcca
gttgagttgctacgtgcaagccttcctcatacaaacgatcagcaacgccagctgctgctt
gattttgctcagcgaacaatgccagtgaccggtattaatcccactggggcaaatggtggg
tacatcacctctgagtctgttcctggttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329076
Entry
4329076           CDS       T01015                                 
Name
(RefSeq) protein PAT1 homolog 1
  KO
K12617  DNA topoisomerase 2-associated protein PAT1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4329076
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4329076
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4329076
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     4329076
SSDB
Motif
Pfam: PAT1
Other DBs
NCBI-GeneID: 4329076
NCBI-ProteinID: XP_015626708
LinkDB
Position
2:complement(11209036..11217798)
AA seq 830 aa
MAAQPSSSASTGDTKFDASQYAFFGNNAVEEVELGGLEDDDGIDAGFVGPGDEEYPSAYG
RDMFEDEGGGSFTGVDDLAGAFSKLTRSINEPTQSGIISRGGSISRQSSTLDWAQDSYWP
TQPIFGAEPGLNNESRWSQPPHLARFADSRLHRTSSSPQQDAQYNPNEHILGAMPSLLHR
TSSYPQQEPQYSHTEPIPVPKSSFIPYPPSGAVSHSSPGQPHNMNMPSPPTSFQMPVSAQ
NELHHPQFPRGGMPPGPLGRSMAHLDSAGLSTNNLQQNALNSGPVRPNGAMLTPGLVQHN
LQRPNGLVPPQMLSRHPQHGMAPIQHSPPQFSQFHAQMLGPRHPPPKGCQMYNPQRPSQM
MSGFDANLAMPDLSDPRARAMLHHGVHGQHYLPQGFELAGMRMDNGWPRFRSKYMSTPEI
ENIARMQQAATQINDPYIDDYYHQACLAKKSAGGQLKHHFCPTLIRDPSSRARSKDEPHA
YLQVDALGRLPFSSIRRPRPLLDVEQTSESSDDVTEKSASKTLDQEPMLAARITIEDGLC
LLLDVDDIDRLLQFSQQQDGGLQLRNRRQALLEQLAESLQLVDPLTPSNNAPLSPNDDLV
FLRIVSLPKGRKLLSRYLELVSSGSELARIACMAVFRHLRFIFGNLPSDSSAVETTTKLA
TAVSTCVVRLELSGLSACLAAIVCSSLQPPLRPLGHAAGDGASFIIKSVLDTATELLTDQ
HVASTYSMQNRALWQASFDAFFGLLTEYCMSKFDSVIHALQTQPAVAAVIGREMPVELLR
ASLPHTNEYQRKQLLGFAQRTVPVNNHSSHGSSNGPMTSESIPSSESWKI
NT seq 2493 nt   +upstreamnt  +downstreamnt
atggcggcgcagccttcttcgtcggcgtcgacgggcgataccaagtttgatgcgtcgcag
tatgctttctttggcaacaacgcggtggaagaagttgagctaggtggattggaggatgat
gatggtatcgatgctggttttgttggtcctggtgatgaagaatacccttctgcttatgga
agggatatgtttgaggatgaaggtggaggttcatttactggcgttgatgatcttgctgga
gcattctcaaagttgaccagaagcatcaatgaaccaacacaatcgggaataattagtcgt
gggggttcaatttctagacaaagttctactctggactgggcacaagattcatattggcct
acacagcctatatttggagctgaaccagggctgaataatgaaagccggtggtctcaacca
cctcatttagcccgctttgctgattctagactgcacagaacatcctcatcgccgcagcaa
gatgctcaatacaatcctaatgaacatattcttggagcaatgccatctctgttgcataga
acttcatcatacccacaacaagagcctcaatacagtcacacagaaccaattccggtacct
aaatcatcattcattccgtaccctccatctggtgcagtatcccattcttcgccaggtcaa
ccacataacatgaacatgccatctcctcccacttcattccaaatgcctgtatctgcacaa
aatgagttacaccatccccagtttcctcgtggtggtatgcctccagggccacttggtcgg
agcatggctcatttggattcagcaggtttatcaactaataatttgcaacagaatgctcta
aacagtgggccagttcgtccaaatggtgccatgcttacaccaggtttggtgcagcacaat
ctgcagcgtccaaatggattggtcccacctcaaatgctgtcacgccatccacaacatgga
atggccccaattcaacactctccgccacaattctcacagttccatgctcagatgcttggt
cctcggcatcctccaccaaaaggttgtcagatgtacaatcctcagcgtccatcacaaatg
atgagtggatttgatgcaaatttggcaatgcctgacttgagtgatccgagagcaagagca
atgctgcaccatggagtgcatggccagcattatctcccccaaggttttgagcttgctggt
atgaggatggataatgggtggccgcggttcagatccaagtacatgtccacgcctgaaatt
gagaacattgcaaggatgcagcaagctgctactcagatcaatgatccgtacattgatgat
tactatcatcaagcctgtttagctaaaaagtcagcaggaggtcaactcaagcaccacttc
tgtccgaccttgattagagatccatcatcccgtgcacggagtaaagatgagccacatgcg
tatctccaggttgatgctcttggaaggttaccattttcttccatccgcaggcctcgtccg
ctcctcgatgttgaacaaacctctgaatcaagtgatgacgttactgaaaaatctgcttca
aaaacacttgaccaagaaccaatgctggctgctagaatcacaattgaagatggcctctgc
ctactgcttgatgtagatgatattgatcgcttgctgcaatttagccagcagcaagatggt
ggcttgcaactgagaaacaggagacaggccctccttgagcagctggcagaatccctgcaa
ctagttgatccacttacacctagtaacaatgcacctctctcaccaaatgatgatctggtg
tttctccgaatagtctctcttccgaagggccgcaagctactttctcgttaccttgaactt
gtgagttctggcagtgagcttgctagaattgcttgcatggcagtcttccggcatctaaga
tttatatttggaaatttgccatctgatagtagtgctgttgagacaacgacaaaacttgct
actgctgtatcaacctgtgttgttcggttggagttgagtggactaagtgcttgccttgca
gctattgtgtgttcttcgctgcaaccccctctgcgaccccttggacatgctgcaggtgat
ggggcttctttcatcataaagtctgtactggacacagcaacagagcttctcactgatcag
catgtggcctctacctacagcatgcaaaacagagctctatggcaagcatcatttgatgcc
ttctttgggctgcttacagagtactgcatgagtaaattcgatagtgtgattcatgcattg
caaacacaacctgctgtggcagcagttataggcagggaaatgccagttgaattgttgcgt
gctagccttccccacacaaatgagtatcagcggaagcagttgctcggttttgctcagcgc
acggtgcctgttaacaaccatagttctcatgggtccagtaatggacccatgacatcagaa
tctatcccaagttcagaaagctggaaaatatga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329480
Entry
4329480           CDS       T01015                                 
Name
(RefSeq) protein PAT1 homolog 1
  KO
K12617  DNA topoisomerase 2-associated protein PAT1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4329480
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4329480
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     4329480
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     4329480
SSDB
Motif
Pfam: PAT1
Other DBs
NCBI-GeneID: 4329480
NCBI-ProteinID: XP_015625828
UniProt: Q0E0W4 Q64M88
LinkDB
Position
2:18705391..18711974
AA seq 815 aa
MRGVESDGGGGAPFSSSSSAAAPDNFDAAQYSFFGKEPLEGLELSCLEDGGGGGGDANGG
GFSGGAEEGLYRLSSVGEEIDNLSNLSDIDDLASTFAKLNRTISGTRNPGVIGDRRSISR
GSSLTVDWAEDVEFPNWVDQDILEDEEFQESKRWWSQSHTLVQQGDAKPLSRTSSYPQQP
LQHRASEPIIPPKSPSFTSFPPPGGRSPYTSQGLTRHGSIPSLGAGLQMGSPSMSLPSSP
YHIAGLSHGLPYGGSMSFGTSNLPVNNPMQNDWPSQANLYAGEQFNLLPNMLQKQISLPN
SPMSSLLFSQQQQRLAQVQVQPSHQNYLNLPPHIFYQHHSPELTGRFDSVSSVPSSRDKR
SRSGRGKHNIRFSQPLPDTGNQNGDSGGIKFRSKYMSSEEIESILRMQHSASHSSDPYVV
DYYHQACIAKRGANSRPKANFAPTSMKDLPSKSRSSGDHHAYLQVDAVGRVSFSSIRRPR
SLLEVDLPSSSDGSHDQKSSLRPLEKEPMLAARVTVEDALCLLLEVDDIDRLLQSSQAQD
NSFQLRRRRQVLLEGLAASLQLVDPLGPSTSSHSSGLAAKDDLVFLRIVSLPKGRKFLSR
YLRLLTPGSELTRIVCMAIFRHLRYLFGGLPSDSSAAETTVTLAKTLSSCVRHMELGALS
ACLAAVVCSPEQPPLRPLASSAGDGASLIIKSVLDRATELLTDQHAAASYTVSNRTLWQA
SFDAFFGLLTKYCLSKYESIRQMFTMQSPGSVIGSEVSKATSREMPVELLRASLPHTNDQ
QRQLLLDFAQRTMPVTGFNASGANGGHITSESVPG
NT seq 2448 nt   +upstreamnt  +downstreamnt
atgcggggcgtcgagtcggatggcggcggcggcgcgcctttctcctcctcctcctccgcg
gccgctccagataatttcgatgccgcgcagtactccttcttcgggaaggagccactggag
gggctcgagctcagttgcttggaggatggcggcggcggcggtggtgatgccaatggcggt
ggattcagtggaggagcagaagaagggctgtaccggctctcctctgttggagaagagatt
gataatctgagtaacttgtccgatattgatgatcttgcgagcacttttgcaaagttgaac
cgaaccattagtggaacacggaatcctggtgttattggtgacagacgatccatctcaaga
ggaagttctctaactgttgattgggctgaagatgtagaatttcctaactgggtagatcaa
gacattttagaggatgaggaatttcaggaaagtaaaagatggtggtcacagtcacacact
ctggtgcagcaaggggatgccaaaccattgagccgaacatcttcctatcctcagcaacca
ctgcagcaccgggcaagtgaacctatcattccaccaaaatctccttcatttacgtccttt
ccaccgccaggtggtagatcaccttatacttctcaaggccttacacgccatgggagcatt
ccatcacttggtgctggcctgcaaatgggttctccaagcatgtcccttccaagttctcca
tatcatatagctggactatctcatggactaccgtatggagggagcatgtccttcggcact
tcaaatctgcctgtaaacaatccaatgcaaaatgattggccaagccaagccaatctttat
gctggggagcaatttaatctactgccgaacatgttacagaaacaaatatcacttccaaat
agcccgatgtcatcactgttattttctcaacagcagcagagattggcacaagttcaagtc
caaccatcccatcagaattacctaaatttaccacctcacatattttaccaacatcactcc
ccagaattaacaggaagatttgattctgttagcagtgttccttcatcaagagacaagaga
tcaaggtcaggaagaggaaaacacaacatacgtttttctcaaccattgcctgatactggt
aatcaaaatggtgatagtggaggaataaaattcagatctaagtacatgtcatctgaagag
atcgaatctatcttaagaatgcaacattcagcaagtcacagcagtgatccttatgtggtt
gattattaccaccaagcttgcatcgcgaaaaggggtgccaattctaggccaaaggccaat
tttgccccaacgtcaatgaaagacttgccttccaagtcccgatccagtggtgaccatcat
gcatatcttcaggttgatgctgtaggaagagtttccttctcttccatacgtaggcctcgt
tctcttcttgaagttgaccttccttcatcaagtgatggttctcatgatcagaagtcttct
ctgagaccattggagaaagaaccaatgctggccgctagagtcactgttgaagatgccctc
tgccttcttcttgaggtggatgatattgaccgtctgttgcagtctagtcaggcacaggat
aacagtttccaactgaggcgaagacggcaggtcctccttgaaggtttagctgcatcactt
cagcttgttgaccctctcgggccgagcacatcaagccattcatctggattggctgctaag
gatgatcttgtttttcttcgcattgtttctcttcctaaaggacgcaagtttttgtcacgt
taccttcgacttcttacccctggaagtgagttgacccgtatagtatgcatggctattttt
cgacatctgaggtacttgttcgggggtttaccatcagattctagtgcagcagaaacaaca
gttactcttgcaaagactctttcatcttgtgtgcgccatatggaactaggtgctcttagt
gcttgccttgctgctgtggtctgttcacctgagcagccacctctgcgtcctctagctagc
tctgctggtgatggggcttctcttattattaaatcagtactggatcgagcaactgagtta
ctgactgaccagcatgccgcagccagctatacagtgtcaaaccggactctctggcaggca
tcatttgatgctttctttggacttctgacaaaatactgtctcagcaagtatgaaagtatt
aggcagatgtttaccatgcagtcaccaggctctgtaattggatctgaggtctccaaagca
accagcagggagatgccggttgagttgctacgtgcaagcctccctcatacaaatgatcag
caacgccagctgctgcttgattttgctcagcgaaccatgccagtgactggttttaatgcc
agcggtgcaaatggtgggcacatcacctccgagtctgttcctggttga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9270665
Entry
9270665           CDS       T01015                                 
Name
(RefSeq) protein PAT1 homolog 1
  KO
K12617  DNA topoisomerase 2-associated protein PAT1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    9270665
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    9270665
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     9270665
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     9270665
SSDB
Motif
Pfam: PAT1
Other DBs
NCBI-GeneID: 9270665
NCBI-ProteinID: XP_015626732
UniProt: A0A0N7KF48 Q6K5B7
LinkDB
Position
2:complement(11292716..11300315)
AA seq 830 aa
MAAQPSSSASTGATKFDASQYAFFGNNAVEEVELGGLEDDDGVDAGFVGPGDEEYPSAYG
RDMFEDEGGGSFTGVDDLAGAFSKLTRSINEPTQSGIISHGGSISRQSSTPDWAQDSYWP
TQPIFGAEQGLDNESRWSQPPHLARFADSRLHRTSSSPQQDAQYNPNEHILGAMPYLLHR
TSSYPQQEPQYNHTEPIPVPKSSFISYPPSGAVSHSSPGQPHHMNMPSPPTSFQMPVSAQ
NELHHPQFPRGGMPPGPLGRNMAHLDSAGLSTNNLQQNALNSGPIRPNGAMLTPGLVQHN
LQRPNGLVPPQMLSRRPQHGMAPIQHSPPQFSQFHAQMLGPRHPPPQGRQMYNPQHSSQM
MSGFDANLAMPDLSDPRARAMLHHGVHGQHYLPQGFELASMRMDNGWPRFRSKYMSTAEI
ENIARMQQAATQINDPYIDDYYHQACLAKKSAGGQLKHHFCPTLIRDPSSCARSKDEPHA
YLQVDALGRLPFSSIRRPRPLLDVEQTSESSDDVTEKSASKTLDQEPMLAARITIEDGLC
LLLDVDDIDRLLQFSQQQDGGLQLRNRRQALLEQLAESLQLVDPLTPSNNGPLSPNDDLV
FLRIVSLPKGRKLLSRYLELVSSGSELARIACMAVFRHLRFIFGNLPSDSSAVETTTKLA
TAVSTCVVRLELSGLSACLAAIVCSSLQPPLRPLGHAAGDGASFIIKSVLDRATELLTDQ
HVASTYSMQNRALWQASFDAFFGLLTEYCMSKFDSVIHALQTQPAVAAVISREMPVELLR
ASLPHTNEYQRKQLLSFSQRTVPVNNHSSHGSNNGPMTSESIPSSESRKI
NT seq 2493 nt   +upstreamnt  +downstreamnt
atggcggcgcagccttcttcgtcggcgtcgacgggcgctaccaagtttgatgcatcgcag
tatgctttctttgggaacaacgcggtggaagaggttgagctaggtggattggaggatgat
gatggtgtcgatgctggttttgttggccctggtgatgaagaatacccttctgcttatgga
agggatatgtttgaggatgaaggtggaggttcatttactggtgttgatgatcttgctgga
gcattctcaaagttgaccagaagcatcaatgaaccaacacaatcgggcataattagtcat
gggggttcaatttctagacaaagttctactccggattgggcacaagattcatattggcct
acgcagcctatatttggagctgaacaagggctggataatgaaagccggtggtctcaacca
ccccatttagcccgctttgctgattctagactgcacagaacatcctcatcgccgcagcaa
gatgctcaatacaatcctaatgaacatattcttggagcaatgccatatctgttgcataga
acttcatcatacccacaacaagagcctcaatacaatcacacagaaccaattccggtacct
aaatcatcattcatttcgtaccctccatctggtgcagtatcccattcttcaccaggtcaa
ccacatcacatgaacatgccatctcctcccacttcattccaaatgcctgtatctgcacaa
aatgagttacaccatccccagtttcctcgtggtggtatgcctccagggccacttggtcgg
aacatggctcatttggattcagcaggtttatcaactaataatttgcaacagaatgctcta
aacagtgggccaattcgtccaaatggtgccatgcttacaccaggtttggtgcagcacaat
ctgcagcgtccaaatggattggtcccacctcaaatgctgtcacgccgtccacaacatgga
atggccccaattcaacactctccgccacaattctcacagttccatgctcagatgcttggt
cctcggcatcctccaccacaaggtcgtcagatgtacaatcctcagcattcatcacaaatg
atgagtggatttgatgcaaatttggcaatgcctgacttgagtgatccgagagcaagagca
atgctgcaccatggagtgcatggccagcattatctcccccaaggttttgagcttgccagt
atgaggatggataatgggtggccgcggttcagatccaagtacatgtccacggctgaaatt
gagaacattgcaaggatgcagcaagctgctactcagatcaatgatccgtacattgatgat
tactatcatcaagcctgtttagctaaaaagtcagcaggaggtcaactcaagcaccacttc
tgtccgaccttgattagagatccatcatcctgtgcacggagtaaagatgagccacatgca
tatctccaggttgatgctcttggaaggttaccattttcttccatccgcaggcctcgtccg
ctcctcgatgttgaacaaacctctgaatcaagtgatgacgttactgaaaaatctgcttca
aaaacacttgaccaagaaccaatgctggctgctaggatcacaattgaagatggcctttgc
ctactgcttgatgtagatgatattgatcgcttgctgcaatttagtcagcagcaagatggt
ggcttgcaactgagaaacaggagacaggccctccttgagcagctggcagaatcgctgcaa
ctagttgatccacttacacctagtaacaatggacctctctcaccaaatgatgatctggtg
tttctccgaatagtctctcttccgaagggccgcaagctactttctcgttaccttgaactt
gttagttctggcagtgagcttgctagaattgcttgcatggcagtcttccggcatctaaga
ttcatatttggaaatttgccatctgatagtagtgctgttgagacaacgacaaaacttgct
actgctgtatcaacctgtgttgttcggttggagttgagtggactaagtgcttgccttgca
gctattgtgtgttcttcgttgcaaccccctctgcgaccccttggacatgctgcaggtgat
ggggcttctttcatcataaagtctgtactggacagagcaacagagcttctcactgatcag
catgtggcctctacctacagcatgcaaaacagagctctatggcaagcatcatttgatgcc
ttctttgggctgcttacagagtattgcatgagtaaattcgatagtgtgattcatgcattg
caaacacaacctgctgtggcagcagttataagcagggaaatgccagttgaattgttgcgt
gccagccttcctcacacaaatgagtatcagcgaaaacagttgctcagtttttctcagcgc
acggtgcctgttaacaaccatagttctcatgggtccaataatggacctatgacatcagaa
tctatcccaagttcagaaagccggaaaatataa

DBGET integrated database retrieval system