KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325651
Entry
4325651           CDS       T01015                                 
Name
(RefSeq) threonine synthase, chloroplastic
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00750  Vitamin B6 metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4325651
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    4325651
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     4325651
SSDB
Motif
Pfam: PALP
Other DBs
NCBI-GeneID: 4325651
NCBI-ProteinID: XP_015621950
UniProt: Q8LJJ2
LinkDB
Position
1:complement(28654043..28655945)
AA seq 525 aa
MATATASSLSLLFAHPHSSNPRPFAGGPHLRRPLRAAPHRARCASDAATTATRHRRPAEE
NIREEAARLRGPGNDFSAWYVPFPPTPEDDPDERYSLDEVVYRSSSGGLLDVCHDMEALA
RFPGSYWRDLFDSRVGRTAWPYGSGVWSKKEFVLPEIDSDHIVSLFEGNSNLFWAERLGR
EHLGGMTDLWVKHCGISHTGSFKDLGMTVLVSQVNRLRRAPLSRPINGVGCASTGDTSAA
LSAYCAAAGIPAIVFLPADRISLQQLIQPIANGATVLSLDTDFDGCMRLIREVTAELPIY
LANSLNSLRLEGQKTAAIEILQQFDWQVPDWVIVPGGNLGNIYAFYKGFEMCRVLGLVDR
VPRLVCAQAANANPLYRFYKSGWTDFQPRVAETTFASAIQIGDPVSVDRAVVALKATDGI
VEEATEEELMDAMSLADRTGMFACPHTGVALAALFKLRDQRIIGPNDRTVVVSTAHGLKF
TQSKIDYHDRNIKDMLCQYANPPINVKADFASVMDVLQNKLNGKI
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggcgaccgccaccgcgtcgtccctctctctcctcttcgcccacccacactcgtccaac
cccaggcccttcgccggcgggcctcacctccgccgcccgctgcgcgccgcgccccaccgc
gcgcgatgcgcctccgacgccgccacgacggccacgaggcaccgccgccccgcggaggag
aacatccgggaggaggccgcgcggctccgcggccccgggaacgacttctcggcgtggtac
gtgccgttccccccgacgcccgaggacgaccccgacgagcgctactcgctggacgaggtg
gtctaccgctccagctccggggggctcctcgacgtgtgccacgacatggaggcgctcgcg
cgcttcccgggctcctactggcgcgacctcttcgactcccgcgtggggcgcaccgcgtgg
ccctacggctccggggtgtggtccaagaaggagttcgtgctcccggagatcgactccgac
cacatcgtctccctcttcgagggcaactccaacctcttctgggcggagcgcctcggccgc
gagcacctcggcgggatgaccgacctctgggttaagcactgcggcatctcgcacacgggc
tccttcaaggacctcggcatgacggtgctcgtcagccaggtgaaccgcctccgccgcgcg
ccgctctcacgccccatcaacggcgtcggctgcgcgtccacgggcgacacctccgccgcg
ctttccgcgtactgcgccgccgcaggtatccccgccatcgtgttcctccccgccgaccgc
atctctctgcagcagctcatccagccaatcgccaacggcgccaccgtgctctcgctggac
acggactttgacgggtgcatgcggctcatcagggaggtgaccgccgagctaccgatttac
cttgccaactcgctgaactcccttcggcttgagggccagaagacggcagccatcgagata
ttgcagcagttcgattggcaggtgccggattgggtcattgttccaggaggcaatcttggg
aatatctatgccttctacaaggggtttgagatgtgccgtgttcttgggcttgttgatcgt
gtgccgcgtcttgtatgcgcacaagctgcaaacgcaaatccgttgtatcggttctacaag
tcagggtggactgatttccagccacgtgtagccgaaactacatttgcatctgccatacag
attggtgatccagtatctgtcgaccgtgcagtggtcgccctgaaggcaactgacggtatt
gttgaggaagctacggaggaagaactcatggatgcaatgtcacttgctgaccgcaccgga
atgtttgcctgcccacacaccggggttgcacttgctgctttgttcaagcttcgagaccag
cgcataatcgggcctaatgaccgcacagtggttgttagtacagcgcatgggcttaagttc
acacaatcgaagatagactaccatgacaggaacatcaaggacatgctgtgccagtacgct
aatccaccaatcaatgtgaaggctgactttgcttctgtgatggatgttctccagaacaag
ctgaatggtaagatctga

KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4339521
Entry
4339521           CDS       T01015                                 
Name
(RefSeq) threonine synthase, chloroplastic
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00260  Glycine, serine and threonine metabolism
osa00750  Vitamin B6 metabolism
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01230  Biosynthesis of amino acids
Module
osa_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    4339521
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    4339521
Enzymes [BR:osa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     4339521
SSDB
Motif
Pfam: PALP
Other DBs
NCBI-GeneID: 4339521
NCBI-ProteinID: XP_015640529
UniProt: Q6L4H5 B9FLG9
LinkDB
Position
5:27290563..27292508
AA seq 521 aa
MAATTHAASLSFLLSHPHPTSPNPNPNPNLPLRRAPHRVRCATDAAATRHRRAADENIRE
EAARHRAPNHNFSAWYAPFPPAPNGDPDERYSLDEIVYRSSSGGLLDVRHDMDALARFPG
SYWRDLFDSRVGRTTWPFGSGVWSKKEFVLPEIDPDHIVSLFEGNSNLFWAERLGRDHLA
GMNDLWVKHCGISHTGSFKDLGMTVLVSQVNRLRRAPLSRPIAGVGCASTGDTSAALSAY
CAAAGIPAIVFLPANRISLEQLIQPIANGATVLSLDTDFDGCMRLIREVTAELPIYLANS
LNSLRLEGQKTAAIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFEMCRVLGLVDRVPRL
VCAQAANANPLYRYYKSGWTEFTPQVAEPTFASAIQIGDPVSVDRAVVALKATDGIVEEA
TEEELMNAMSLADRTGMFACPHTGVALAALFKLRDQRIIGPNDRTVVVSTAHGLKFSQSK
IDYHDSKIEDMACKYANPPVSVKADFGAVMDVLKKRLKGKL
NT seq 1566 nt   +upstreamnt  +downstreamnt
atggcggccaccacccacgccgcctccctctccttcctcctctctcacccccaccccacc
tcccccaaccctaaccctaaccctaacctccccctccgccgcgccccccaccgcgtccgc
tgcgccaccgacgccgccgccaccaggcaccggcgcgcggccgacgagaacatccgggag
gaggcggcgaggcaccgcgccccgaaccacaacttctccgcgtggtacgcgcccttcccg
cccgcccccaacggcgaccccgacgagcgctactccctggacgagatcgtctaccgctcc
agctcgggcggcctcctcgacgtgcgccacgacatggacgcgctcgcccgcttcccgggc
tcctactggcgcgacctcttcgactcccgcgtcggccgcaccacctggcccttcggctcc
ggcgtctggtccaagaaggagttcgtcctccccgagatcgaccccgaccacatcgtctcc
ctcttcgagggcaactccaacctcttctgggcggagcgcctcggccgcgaccacctcgcc
gggatgaacgacctctgggtcaagcactgcggcatctcccacaccggatcgttcaaggat
ctcggcatgacggtgctcgtcagccaggtgaaccgcctccgccgcgcgccgctctcccgc
cccatcgccggagtcgggtgcgcctccacgggggacacctccgccgcgctctcggcctac
tgcgccgccgcggggatcccggccattgtgttcctccccgccaaccgcatctcgctcgag
cagctcatccagcccattgccaatggcgccaccgtgctctcgctcgacacggacttcgac
ggctgcatgcggctcatcagggaggtgactgccgagctgccgatttaccttgcgaattca
ttgaattcccttcggctcgaggggcagaagactgctgctattgagattcttcagcagttc
gattgggaggtgccggattgggtcattgttcccggaggcaatcttgggaacatatatgcc
ttctacaagggattcgagatgtgccgcgtccttgggctcgtcgatcgtgtgccgcggctt
gtctgcgcgcaggctgccaatgcgaacccgctgtaccggtactacaagtcggggtggact
gagttcacgccgcaggtggctgagccgacatttgcatcggcaattcagattggtgacccg
gtatctgtcgatcgcgcggtggttgcgctcaaggcaactgatggcatcgtcgaggaggcc
acggaggaggaactcatgaacgcaatgtcgctcgctgatcgcactggcatgtttgcttgc
ccgcatactggggttgccctcgcagcactgttcaagctccgtgaccagcgcatcatcggg
ccaaatgaccgcacggtagtcgtcagcacagctcatggtctgaagttctcacagtccaag
atcgactaccatgacagcaagatcgaagacatggcctgcaagtatgcgaatcccccggtc
agcgtgaaggctgacttcggtgccgtcatggatgtcctcaagaagaggctcaagggtaag
ctctga

DBGET integrated database retrieval system