KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325901
Entry
4325901           CDS       T01015                                 
Name
(RefSeq) non-canonical poly(A) RNA polymerase PAPD5
  KO
K03514  non-canonical poly(A) RNA polymerase PAPD5/7 [EC:2.7.7.19]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    4325901
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:osa03019]
    4325901
   03016 Transfer RNA biogenesis [BR:osa03016]
    4325901
Enzymes [BR:osa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.19  polynucleotide adenylyltransferase
     4325901
Messenger RNA biogenesis [BR:osa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    TRAMP complex
     4325901
Transfer RNA biogenesis [BR:osa03016]
 Eukaryotic type
  tRNA degradation factors
   TRAMP complex
    4325901
SSDB
Motif
Pfam: PAP_assoc NTP_transf_2 TUTase DNA_pol_B_palm Polbeta LPD29 Nrap_D2
Other DBs
NCBI-GeneID: 4325901
NCBI-ProteinID: XP_015622135
LinkDB
Position
1:27624625..27630397
AA seq 630 aa
MARKARPAEPPTPGRKGRKPLPSHAPPTEAAAAAATAAASPAAATASPAADAMEAEAGGV
AIVYDALPGLTLAFSPEEEEHLEGATADLGGASTSASAAVVEEVEDATAAYSVFRNEITA
AGDALVDIPAADFFSLDVSAAVEDEPATPRALSPQPAPEATLSGSLAPAEQPAQGSERAW
FRGGRRFRSPMLQLHKEILDFCDFISPSAEEQSSRTAAVKAVSNVIKHIWPQCKVEVFGS
FRTGLFLPTSDIDVVIFDSRVKTPQVGLYALAKALSQKGVAKKIQVIAKARVPIVKFVER
KSEIAFDISFDMDGGPQAADFIKDYVKKFPALRHLCMILKVFLHQRELNEVYTGGIGSYA
LLTMLITHLQLIWGGKDILGYRKKEHNLGILLIALFDFYGRKLNNWDVGISCNSARTFFL
KTDKNFANPDRAYLLAIQDPMVPDNDIGKNSFNYFKVKSAFSKAYSVLTDANLITSLGPN
RSILGTIVRPDSVLLDRKGWNKDATIPDMLTEPWEPLPRQFDSDNDAVYNWHVIDDEPLP
RNTRSSSEDTRPSPTQKRKSSKPKQRSRKKAKADSSSGNNAENGFKRGKGLAQCDRSHQS
AGSSRRSKGPREYDRFTNTLPQYTQHISRW
NT seq 1893 nt   +upstreamnt  +downstreamnt
atggctcgcaaagcgcgacccgcggagcctcctacaccggggcggaagggcaggaaacct
ctcccctcccacgcgccgccgaccgaagccgccgccgccgccgccaccgccgccgcctct
ccagccgcagccaccgcctctccagccgcagacgccatggaggccgaagcgggcggcgtg
gccatcgtgtacgacgcgctcccggggctgacactggcgttctcgccggaggaggaggag
cacctagagggtgcgactgccgacctaggcggcgcgtcgacctccgcctcggctgcggtg
gtggaggaggtggaggacgccaccgcggcctactccgtgttccgcaacgagatcacggcg
gctggggacgcgctcgtcgatatccccgcggcggatttcttctccctcgacgtgtcggcg
gcagttgaagacgagccggccaccccgcgtgcgttgtcgccgcagcctgctccggaggcg
acgctatcgggttctctagctcccgctgagcagccagcgcaggggtcggagcgcgcgtgg
tttcggggagggaggcggttcaggagccctatgctgcagcttcacaaagagattcttgac
ttctgtgactttatatcaccttctgctgaagaacaatcttcacgaacagctgctgtgaaa
gctgtctccaatgttatcaaacatatatggcctcaatgcaaggtggaggtcttcggatct
tttagaacagggctgtttttaccaacaagtgatatcgatgttgtaatatttgactccagg
gttaagactccacaagttggcctgtatgctcttgcaaaagcattgtctcagaaaggggtt
gctaaaaagatacaggtaatagcaaaggcccgtgtgccaattgtgaagttcgtggagaga
aaaagtgaaatagcttttgacataagttttgacatggatggtggaccacaagcagcagac
ttcatcaaggattatgtgaagaagtttcctgctttaagacatctgtgtatgattctgaaa
gtttttttacaccaaagagagcttaatgaggtctatacgggtggaattggttcatatgct
cttctcactatgctcatcacacatttacagttgatctggggaggcaaagatatactgggg
tatcgtaaaaaggagcacaatttggggattcttttgatcgcattatttgatttttatgga
cgcaagttgaacaattgggatgttggaatatcctgcaattctgctaggacctttttcttg
aagactgataaaaactttgcaaatcctgatcgagcataccttctagctattcaagatcct
atggtaccagataatgatattgggaagaactcatttaactatttcaaggtgaaatcagca
ttttcaaaggcttattctgtgttaaccgatgcgaacttgataacaagcttggggcccaat
aggagcattctgggtaccattgtcagaccagactccgtgctcctagaccggaaaggctgg
aacaaggacgctacaatacctgacatgttaacagaaccctgggaaccattaccccgtcag
tttgatagcgataatgatgcagtctataattggcatgtgatagatgatgaaccactgccc
aggaatactcgatcctcatcggaggacacaaggccatcacctacacaaaaaaggaagtct
tccaaaccaaaacagagatcgcggaaaaaggccaaggctgattcttcgagtggtaacaat
gctgaaaatggtttcaagcgggggaaaggattagcacaatgtgatagatcgcatcaaagt
gcaggaagcagcagacggagcaaagggccgagagagtatgacagatttacaaataccctc
ccacaatatactcagcacattagtaggtggtga

DBGET integrated database retrieval system