KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4326074
Entry
4326074           CDS       T01015                                 
Name
(RefSeq) probable fructose-bisphosphate aldolase 3, chloroplastic
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00010  Glycolysis / Gluconeogenesis
osa00030  Pentose phosphate pathway
osa00051  Fructose and mannose metabolism
osa00710  Carbon fixation in photosynthetic organisms
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01230  Biosynthesis of amino acids
Module
osa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
osa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
osa_M00165  Reductive pentose phosphate cycle (Calvin cycle)
osa_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
osa_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    4326074
   00030 Pentose phosphate pathway
    4326074
   00051 Fructose and mannose metabolism
    4326074
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    4326074
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4326074
   03036 Chromosome and associated proteins [BR:osa03036]
    4326074
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4326074
Enzymes [BR:osa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     4326074
Membrane trafficking [BR:osa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    4326074
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    4326074
Exosome [BR:osa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4326074
SSDB
Motif
Pfam: Glycolytic
Other DBs
NCBI-GeneID: 4326074
NCBI-ProteinID: XP_015643260
UniProt: Q94JJ0 A0A0P0UXT2
LinkDB
Position
1:1016035..1019495
AA seq 388 aa
MAMLTAKLTSPPAATTWLPGGGRRSAPPRRATVIRAAAVSYADELVSTAKSVASPGRGIL
AIDESNATCGKRLASIGLDNTEVNRQAYRQLLLTTAGLGEYISGAILFEETLYQSTTDGK
KFVDCLKDQNIMPGIKVDKGLVPLPGSNNESWCQGLDGLASRCAEYYKQGARFAKWRTVV
SIPCGPSALAVKEAAWGLARYAAIAQDNGLVPIVEPEILLDGDHAIERTLEVAEKVWSEV
FFYLAQNNVLFEGILLKPSMVTPGAEHKQKATPEAIAKHTLTMLRRRVPPAVPGIMFLSG
GQSEVEATLNLNAMNQEPNPWHVSFSYARALQNSVLKTWQGRPENVEAAQKALLVRAKAN
SLAQLGRYTGEGESDEAKKGMFQKGYTY
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggcgatgctgacggccaagctcacctccccccccgccgccaccacctggctccccggc
ggcggccgccgatccgcgccgccccgccgtgctacggtgatccgcgccgccgccgtctcc
tacgccgacgagctcgtctccaccgcgaaatctgttgcttccccagggcgtggtatcctg
gcaattgatgagtcgaatgccacatgcggaaagagattagcatccattggtttggacaac
acagaagttaaccgccaggcttacaggcagcttttactgaccactgctggtcttggtgaa
tatatttctggtgctatcctttttgaggaaactctttatcagtcaaccactgatggtaag
aagtttgttgactgcttgaaggatcagaatatcatgcccggtatcaaggtcgacaagggc
ttggttccattgcctgggtccaacaatgaatcttggtgccaaggcctagatggtttggct
tcaaggtgtgctgagtactacaagcagggggcacgcttcgctaagtggcggactgttgtt
agcatcccttgtggtccctcagcattagcagtcaaggaagcggcatggggacttgctcga
tatgctgccattgctcaggacaatggcttagtgccaattgttgagccagagatccttctt
gatggtgaccatgcgatcgagagaactcttgaagtggcagagaaagtgtggtctgaggta
ttcttctacctggcccaaaacaatgttctttttgagggtatcctgctgaaacccagcatg
gtgacccctggagctgaacacaagcagaaggccactccagaagccattgcgaagcacacc
cttacaatgctgaggaggagagtgccgcctgctgtccctggaatcatgttcctttctggt
gggcaatctgaggtggaggcaaccctgaacctgaacgcgatgaaccaagaaccaaaccca
tggcatgtgtccttctcatacgcccgggctctccagaactcggtgctgaagacatggcag
gggcgccccgagaacgtggaggcagcgcagaaggcactgctggtccgtgccaaggcgaac
tcgctggctcagctcggtcgctacaccggcgagggcgagagcgatgaggccaagaaggga
atgttccagaagggctacacttactga

DBGET integrated database retrieval system